Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1512
Gene name
LocationContig_146:9059..11015
Strand-
Gene length (bp)1956
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.8E-10 244 304
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.4E-08 332 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2L4W6|SPO5_SCHPO Sporulation-specific protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo5 PE=1 SV=1 180 435 4.0E-52
sp|B4MM23|SHEP_DROWI Protein alan shepard OS=Drosophila willistoni GN=shep PE=3 SV=2 243 445 2.0E-30
sp|B4LFQ9|SHEP_DROVI Protein alan shepard OS=Drosophila virilis GN=shep PE=3 SV=2 243 445 4.0E-30
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 243 445 8.0E-30
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 243 445 9.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2L4W6|SPO5_SCHPO Sporulation-specific protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo5 PE=1 SV=1 180 435 4.0E-52
sp|B4MM23|SHEP_DROWI Protein alan shepard OS=Drosophila willistoni GN=shep PE=3 SV=2 243 445 2.0E-30
sp|B4LFQ9|SHEP_DROVI Protein alan shepard OS=Drosophila virilis GN=shep PE=3 SV=2 243 445 4.0E-30
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 243 445 8.0E-30
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 243 445 9.0E-30
sp|B4HUE4|SHEP_DROSE Protein alan shepard OS=Drosophila sechellia GN=shep PE=3 SV=1 243 445 1.0E-29
sp|Q8MSV2|SHEP_DROME Protein alan shepard OS=Drosophila melanogaster GN=shep PE=1 SV=2 243 445 1.0E-29
sp|B4IX08|SHEP_DROGR Protein alan shepard OS=Drosophila grimshawi GN=shep PE=3 SV=1 243 438 2.0E-29
sp|B4KX02|SHEP_DROMO Protein alan shepard OS=Drosophila mojavensis GN=shep PE=3 SV=1 243 445 3.0E-29
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 243 394 1.0E-27
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 243 394 1.0E-27
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 243 394 2.0E-27
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 243 407 3.0E-27
sp|B3M3R5|SHEP_DROAN Protein alan shepard OS=Drosophila ananassae GN=shep PE=3 SV=2 243 445 4.0E-27
sp|Q5RBD3|RBMS3_PONAB RNA-binding motif, single-stranded-interacting protein 3 OS=Pongo abelii GN=RBMS3 PE=2 SV=1 243 391 4.0E-27
sp|Q6XE24|RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens GN=RBMS3 PE=1 SV=1 243 391 4.0E-27
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 243 394 5.0E-27
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 243 407 6.0E-27
sp|Q8BWL5|RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus GN=Rbms3 PE=2 SV=2 243 391 7.0E-27
sp|Q15434|RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens GN=RBMS2 PE=1 SV=1 243 394 9.0E-27
sp|B4QRJ0|SHEP_DROSI Protein alan shepard OS=Drosophila simulans GN=shep PE=3 SV=1 243 445 1.0E-26
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 215 422 4.0E-20
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 215 430 8.0E-20
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 260 423 3.0E-17
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 260 423 4.0E-17
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 260 423 4.0E-17
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 260 423 6.0E-16
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 260 423 6.0E-16
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 260 423 6.0E-16
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 260 423 6.0E-16
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 260 412 2.0E-15
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 237 424 3.0E-15
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 237 424 3.0E-15
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 260 412 5.0E-15
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 260 412 5.0E-15
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 260 412 6.0E-15
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 237 430 9.0E-15
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 243 392 1.0E-14
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 241 392 2.0E-14
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 237 430 2.0E-14
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 241 392 3.0E-14
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 260 412 3.0E-14
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 237 430 3.0E-14
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 237 424 5.0E-14
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 237 430 5.0E-14
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 237 430 6.0E-14
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 237 430 6.0E-14
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 237 430 6.0E-14
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 237 430 6.0E-14
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 260 412 8.0E-14
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 224 422 1.0E-13
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 243 392 1.0E-13
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 243 392 1.0E-13
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 243 392 2.0E-13
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 236 430 3.0E-13
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 280 423 3.0E-13
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 243 417 3.0E-13
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 280 423 3.0E-13
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 240 391 6.0E-13
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 229 413 1.0E-12
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 229 413 1.0E-12
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 243 449 1.0E-12
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 243 449 1.0E-12
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 240 413 2.0E-12
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 237 431 2.0E-12
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 243 424 2.0E-12
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 237 424 4.0E-12
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 237 429 9.0E-12
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 236 430 1.0E-11
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 236 430 1.0E-11
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 236 419 2.0E-11
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 253 413 2.0E-11
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 237 427 3.0E-11
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 239 419 3.0E-11
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 240 391 3.0E-11
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 239 419 3.0E-11
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 236 430 3.0E-11
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 239 419 3.0E-11
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 243 424 3.0E-11
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 237 429 4.0E-11
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 237 429 4.0E-11
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 239 419 4.0E-11
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 240 413 5.0E-11
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 239 419 5.0E-11
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 240 401 6.0E-11
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 243 448 7.0E-11
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 241 401 7.0E-11
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 237 426 8.0E-11
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 237 438 9.0E-11
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 243 429 1.0E-10
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 243 429 1.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 239 419 1.0E-10
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 243 401 2.0E-10
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 243 401 2.0E-10
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 243 401 2.0E-10
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 243 401 2.0E-10
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 243 401 2.0E-10
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 237 425 2.0E-10
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 243 401 3.0E-10
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 215 419 3.0E-10
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 243 429 3.0E-10
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 244 401 4.0E-10
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 239 401 4.0E-10
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 244 401 4.0E-10
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 243 425 8.0E-10
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 228 447 9.0E-10
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 243 409 9.0E-10
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 244 391 9.0E-10
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 243 425 1.0E-09
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 243 401 1.0E-09
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 243 401 1.0E-09
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 243 424 1.0E-09
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 243 409 1.0E-09
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 244 391 1.0E-09
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 244 391 1.0E-09
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 239 419 1.0E-09
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 244 435 1.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 244 401 1.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 237 429 1.0E-09
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 240 429 2.0E-09
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 243 429 2.0E-09
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 239 401 2.0E-09
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 237 424 2.0E-09
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 237 430 2.0E-09
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 237 426 2.0E-09
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 241 401 3.0E-09
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 243 420 4.0E-09
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 243 401 4.0E-09
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 238 422 5.0E-09
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 228 403 5.0E-09
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 228 429 6.0E-09
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 243 401 6.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 237 429 6.0E-09
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 243 420 6.0E-09
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 242 402 7.0E-09
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 241 402 8.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 243 429 8.0E-09
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 237 424 8.0E-09
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 236 401 9.0E-09
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 243 401 1.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 243 447 1.0E-08
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 228 429 1.0E-08
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 228 429 1.0E-08
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 237 424 1.0E-08
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 237 424 1.0E-08
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 243 429 1.0E-08
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 237 424 1.0E-08
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 243 447 1.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 237 417 1.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 237 417 1.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 237 417 1.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 237 417 1.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 237 417 1.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 237 417 1.0E-08
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 243 429 2.0E-08
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 243 429 2.0E-08
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 237 424 2.0E-08
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 237 424 2.0E-08
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 228 429 3.0E-08
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 228 429 3.0E-08
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 228 429 3.0E-08
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 240 397 3.0E-08
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 237 424 3.0E-08
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 196 365 3.0E-08
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 243 401 4.0E-08
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 243 394 4.0E-08
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 237 434 4.0E-08
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 252 413 4.0E-08
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 243 449 6.0E-08
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 244 390 6.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 232 394 1.0E-07
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 186 462 1.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 243 403 2.0E-07
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 219 377 2.0E-07
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 244 391 2.0E-07
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 242 402 2.0E-07
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 228 448 3.0E-07
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 244 394 4.0E-07
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 228 448 4.0E-07
sp|Q8GZ26|BRN2L_ARATH RNA-binding protein BRN2 OS=Arabidopsis thaliana GN=BRN2 PE=2 SV=1 253 417 4.0E-07
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 237 424 5.0E-07
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 244 419 5.0E-07
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 244 410 5.0E-07
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 242 402 9.0E-07
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 228 429 1.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 243 424 1.0E-06
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 237 424 1.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 243 446 1.0E-06
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 207 311 2.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 207 311 3.0E-06
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 207 311 3.0E-06
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 242 386 3.0E-06
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 244 401 3.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 244 421 3.0E-06
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 244 376 4.0E-06
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 244 376 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1512
MDASTLANPYAPNGRHALAAHNTGDPNSMMGQFAGLTIGSMGMSANSTHMPLGPGHFMVGPDGQLILTPMSAGHS
VGINHSQESAFNNFGIPATGYGHPYVGVPMPLLPFTPARANAAQRPAERGGHTSDVPGLENRRGSYSTTESTPAT
PFYGAVSQRDGGPRVASLDRSAYTTPSPQQLGVPSLHGEPAKATVATVSDRHIDDLLEKDPAVPRAVPAVFTPPG
QMKTLEQSLENRIPGNRNVYIRGLHPTTDDGLLYEFASRFGPVETSKAIIDTNTGACKGFGFAKFCDVRDSELCI
RGFHRLGYEVGFARESFNSRLKAEGDECSTNLYISNLPKSLTEVELATIFLGYTILSSKILRDSMGNSRGVGFAR
FEGREICDEVIRKFNGVSIGEEGLLMNIRYADTPAQKELKRVTAERRQFRTNEYNIGAYGTPLVGMSPTLYGQPQ
WRRALPVSRSGISSFSIDESNAGRIVPSRRGASVTATSTSTDAAVSTPNSSECDEGVTIQADSTVVAVAVAGESV
QASPSGKKDIKKEAH*
Coding >OphauG2|1512
ATGGATGCTTCAACTTTGGCCAATCCATATGCCCCCAACGGACGCCATGCTCTGGCAGCCCACAACACTGGAGAT
CCAAACTCTATGATGGGTCAGTTTGCTGGTCTGACAATTGGCAGCATGGGAATGTCCGCCAATTCAACACATATG
CCTCTTGGACCTGGCCACTTCATGGTGGGGCCAGATGGTCAGTTAATTCTGACTCCCATGTCGGCCGGCCATTCT
GTCGGCATCAATCATTCTCAGGAATCAGCCTTCAATAATTTTGGCATTCCTGCCACAGGTTACGGCCACCCATAC
GTTGGAGTTCCAATGCCACTTCTTCCCTTTACCCCAGCAAGGGCCAACGCTGCCCAGCGTCCCGCCGAACGTGGA
GGCCATACATCTGATGTGCCAGGCTTGGAGAATCGTCGTGGTTCTTACTCGACGACCGAGTCGACTCCAGCGACC
CCTTTCTATGGAGCTGTTTCGCAGCGCGACGGCGGTCCCCGAGTGGCTAGCCTGGATCGATCGGCATACACTACG
CCTTCGCCGCAGCAACTGGGTGTTCCATCTCTGCATGGCGAACCCGCCAAGGCGACTGTGGCTACTGTCTCAGAT
CGTCACATCGATGATTTGCTTGAGAAGGACCCTGCTGTTCCTCGAGCTGTTCCCGCTGTCTTTACTCCGCCTGGC
CAGATGAAGACTCTGGAGCAGAGCCTGGAGAACCGTATTCCGGGAAATCGTAATGTCTACATTCGTGGACTGCAT
CCCACGACTGACGACGGGCTCTTGTATGAGTTCGCGTCTCGTTTTGGGCCCGTTGAGACGTCCAAAGCCATAATT
GACACCAACACTGGAGCCTGCAAAGGCTTTGGCTTCGCCAAGTTTTGCGACGTTCGCGATTCGGAGCTTTGCATC
CGTGGTTTCCATCGTCTCGGCTACGAAGTCGGATTTGCTCGAGAGTCTTTCAACTCCCGCCTCAAGGCAGAGGGA
GACGAATGCTCGACCAATCTATATATCTCTAATCTTCCCAAGAGTTTGACCGAGGTTGAGCTGGCCACCATCTTT
CTCGGATACACAATCTTATCCAGCAAGATACTGCGCGATAGCATGGGCAACAGCCGTGGTGTTGGATTTGCCCGC
TTCGAGGGGCGTGAAATCTGTGACGAAGTCATTCGCAAGTTCAACGGCGTCAGTATCGGAGAGGAAGGGCTCCTT
ATGAATATTCGCTACGCAGACACGCCTGCTCAAAAGGAACTGAAGCGCGTCACGGCCGAGCGTCGCCAGTTTCGC
ACCAATGAGTACAACATTGGTGCATATGGCACCCCTTTGGTGGGAATGAGCCCCACGCTCTATGGCCAGCCCCAG
TGGCGACGAGCTCTCCCCGTGTCCCGGAGCGGTATCTCGTCGTTTTCCATCGATGAGAGCAATGCGGGCAGAATT
GTGCCGTCGCGTCGTGGGGCATCAGTGACGGCTACGAGCACGAGTACGGATGCTGCTGTTTCTACACCGAACTCA
TCCGAGTGTGATGAGGGCGTTACGATTCAAGCGGATTCGACCGTCGTCGCTGTTGCCGTTGCTGGCGAGAGTGTT
CAAGCGTCGCCTTCCGGCAAGAAGGACATTAAAAAGGAGGCGCATTGA
Transcript >OphauG2|1512
ATGGATGCTTCAACTTTGGCCAATCCATATGCCCCCAACGGACGCCATGCTCTGGCAGCCCACAACACTGGAGAT
CCAAACTCTATGATGGGTCAGTTTGCTGGTCTGACAATTGGCAGCATGGGAATGTCCGCCAATTCAACACATATG
CCTCTTGGACCTGGCCACTTCATGGTGGGGCCAGATGGTCAGTTAATTCTGACTCCCATGTCGGCCGGCCATTCT
GTCGGCATCAATCATTCTCAGGAATCAGCCTTCAATAATTTTGGCATTCCTGCCACAGGTTACGGCCACCCATAC
GTTGGAGTTCCAATGCCACTTCTTCCCTTTACCCCAGCAAGGGCCAACGCTGCCCAGCGTCCCGCCGAACGTGGA
GGCCATACATCTGATGTGCCAGGCTTGGAGAATCGTCGTGGTTCTTACTCGACGACCGAGTCGACTCCAGCGACC
CCTTTCTATGGAGCTGTTTCGCAGCGCGACGGCGGTCCCCGAGTGGCTAGCCTGGATCGATCGGCATACACTACG
CCTTCGCCGCAGCAACTGGGTGTTCCATCTCTGCATGGCGAACCCGCCAAGGCGACTGTGGCTACTGTCTCAGAT
CGTCACATCGATGATTTGCTTGAGAAGGACCCTGCTGTTCCTCGAGCTGTTCCCGCTGTCTTTACTCCGCCTGGC
CAGATGAAGACTCTGGAGCAGAGCCTGGAGAACCGTATTCCGGGAAATCGTAATGTCTACATTCGTGGACTGCAT
CCCACGACTGACGACGGGCTCTTGTATGAGTTCGCGTCTCGTTTTGGGCCCGTTGAGACGTCCAAAGCCATAATT
GACACCAACACTGGAGCCTGCAAAGGCTTTGGCTTCGCCAAGTTTTGCGACGTTCGCGATTCGGAGCTTTGCATC
CGTGGTTTCCATCGTCTCGGCTACGAAGTCGGATTTGCTCGAGAGTCTTTCAACTCCCGCCTCAAGGCAGAGGGA
GACGAATGCTCGACCAATCTATATATCTCTAATCTTCCCAAGAGTTTGACCGAGGTTGAGCTGGCCACCATCTTT
CTCGGATACACAATCTTATCCAGCAAGATACTGCGCGATAGCATGGGCAACAGCCGTGGTGTTGGATTTGCCCGC
TTCGAGGGGCGTGAAATCTGTGACGAAGTCATTCGCAAGTTCAACGGCGTCAGTATCGGAGAGGAAGGGCTCCTT
ATGAATATTCGCTACGCAGACACGCCTGCTCAAAAGGAACTGAAGCGCGTCACGGCCGAGCGTCGCCAGTTTCGC
ACCAATGAGTACAACATTGGTGCATATGGCACCCCTTTGGTGGGAATGAGCCCCACGCTCTATGGCCAGCCCCAG
TGGCGACGAGCTCTCCCCGTGTCCCGGAGCGGTATCTCGTCGTTTTCCATCGATGAGAGCAATGCGGGCAGAATT
GTGCCGTCGCGTCGTGGGGCATCAGTGACGGCTACGAGCACGAGTACGGATGCTGCTGTTTCTACACCGAACTCA
TCCGAGTGTGATGAGGGCGTTACGATTCAAGCGGATTCGACCGTCGTCGCTGTTGCCGTTGCTGGCGAGAGTGTT
CAAGCGTCGCCTTCCGGCAAGAAGGACATTAAAAAGGAGGCGCATTGA
Gene >OphauG2|1512
ATGGATGCTTCAACTTTGGCCAATCCATATGCCCCCAACGGACGCCATGCTCTGGCAGCCCACAACACTGGAGAT
CCAAACTCTATGATGGGTCAGTTTGCTGGTCTGACAATTGGCAGCATGGGAATGTCCGCCAATTCAACACATATG
CCTCTTGGACCTGGCCACTTCATGGTGGGGCCAGATGGTCAGTTAATTCTGACTCCCATGTCGGCCGGCCATTCT
GTCGGCATCAATCATTCTCAGGAATCAGCCTTCAATAATTTTGGCATTCCTGCCACAGGTTACGGCCACCCATAC
GTTGGAGTTCCAATGCCACTTCTTCCCTTTACCCCAGCAAGGGCCAACGCTGCCCAGCGTCCCGCCGAACGTGGA
GGCCATACATCTGATGTGCCAGGCTTGGAGAATCGTCGTGGTTCTTACTCGACGACCGAGTCGACTCCAGCGACC
CCTTTCTATGGAGCTGTTTCGCAGCGCGACGGCGGTCCCCGAGTGGCTAGCCTGGATCGATCGGCATACACTACG
CCTTCGCCGCAGCAACTGGGTGTTCCATCTCTGCATGGCGAACCCGCCAAGGCGACTGTGGCTACTGTCTCAGAT
CGTCACATCGATGATTTGCTTGAGAAGGACCCTGCTGTTCCTCGAGCTGTTCCCGCTGTCTTTACTCCGCCTGGC
CAGATGAAGACTCTGGAGCAGAGCCTGGAGAACCGTATTCCGGGAAATCGTAATGTCTACATTCGTGGACTGCAT
CCCACGACTGACGACGGGCTCTTGTATGAGTTCGCGTCTCGTTTTGGGCCCGTTGAGACGTCCAAAGCCATAATT
GACACCAACACTGGAGCCTGCAAAGGGCAAGTTCCGTCGTGGTTGCCTAGCTCGGCTACCTTTTGCTAACTGACA
GTAGCTTTGGCTTCGCCAAGTTTTGCGACGTTCGCGATTCGGAGCTTTGCATCCGTGGTTTCCATCGTCTCGGCT
ACGAAGTCGGATTTGCTCGAGTCAGCCTCTCCTTTGCAACTGCTTCTTATTGATCGTTGCTGACCGACTCTATAG
GAGTCTTTCAACTCCCGCCTCAAGGCAGAGGGAGACGAATGCTCGACCAATCTATATATCTCTAATCTTCCCAAG
AGTTTGACCGAGGTTGTGAGTGCAGTAATGCATTTGGCGGCACCATGACTGCAAATTGACTTGAATTTCTTTCCA
TAGGAGCTGGCCACCATCTTTCTCGGATACACAATCTTATCCAGCAAGATACTGCGCGATAGCATGGGCAACAGC
CGTGGTGTTGGATTTGCCCGGTAAGATTAGATTGCGAGATAGATCATTTTATGCCATGGCTGACTGTCATTCAAG
CTTCGAGGGGCGTGAAATCTGTGACGAAGTCATTCGCAAGTTCAACGGCGTCAGTATCGGAGAGGAAGGGCTCCT
TATGAATATTCGCTACGCAGACACGCCTGCTCAAAAGGAACTGAAGCGCGTCACGGCCGAGCGTCGCCAGTTTCG
CACCAATGAGTACAACATTGGTGCATATGGCACCCCTTTGGTGGGAATGAGCCCCACGCTCTATGGCCAGCCCCA
GTGGCGACGAGCTCTCCCCGTGTCCCGGAGGTAATATTTCGTGTCGTGTCTAGCGCTTCTCAAGGTTGACTGCTG
TTTCTCTCTGCAGCGGTATCTCGTCGTTTTCCATCGATGAGAGCAATGCGGGCAGAATTGTGCCGTCGCGTCGTG
GGGCATCAGTGTATGGTGGCCAAGTAAGCTGTTTCCGCACCTACTGACCTCTTGACCAGGACGGCTACGAGCACG
AGTACGGATGCTGCTGTTTCTACACCGAACTCATCCGAGTGTGATGAGGGCGTTACGATTCAAGCGGATTCGACC
GTCGTCGCTGTTGCCGTTGCTGGCGAGAGTGTTCAAGCGTCGCCTTCCGGCAAGAAGGACATTAAAAAGGAGGCG
CATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail