Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1502
Gene name
LocationContig_1455:656..2292
Strand-
Gene length (bp)1636
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2500
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1502 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|756
Ophiocordyceps camponoti-floridani Ophcf2|06024
Ophiocordyceps camponoti-rufipedis Ophun1|6835
Ophiocordyceps kimflemingae Ophio5|391
Ophiocordyceps subramaniannii Hirsu2|3623

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1502
MDPTTTLITFLLQTDPTVQTVELIGSWDNFSSCYAMKRDVRRGQGQWRGCYSFKNIVCDDNNALKRTKRNGGLKM
GATYYYYYEIDGSIETYDSAEPWTTSCPYLPGQAVNTLIVPVEHSFRKRSASLNSMREESFRTMDPNAKFTKPQP
LPTLMAETSRRRLDTATPIFHTRPALCPPSPISLWRRLFGRRQSNQTPTPTRDAQTKLAPPTEMDQMRGLTSSDC
SISGLPSCEPMQQLPSQHIAGALQPRCSREPVLSIPEDIVEEVHDQVPSLGPAAPQRAGQAASLPHNSAQVEGFG
SAKTVSKVACSPSISSSILTSSVSPTLGEDEPPSFYDSNDDDEVLSSNDGDNYPHQSLPSLCAPGYGFAGYSLPR
QTDYTKGMTSSPPMQAFGSPRLVARNEATVPMSGTNLLATTIDSDLDDFVHEMGWMVGVIGNKQA*
Coding >OphauG2|1502
ATGGATCCCACGACTACCCTCATCACCTTCTTGCTCCAAACGGACCCTACAGTTCAAACTGTTGAGCTCATTGGC
TCATGGGACAATTTTTCATCATGTTATGCCATGAAGCGAGACGTGAGGCGCGGCCAGGGACAATGGAGAGGATGC
TACTCCTTCAAGAATATTGTTTGCGACGACAACAATGCTCTCAAACGGACAAAAAGAAATGGCGGTCTCAAAATG
GGCGCCACTTACTACTACTATTATGAGATAGACGGCTCCATTGAGACATATGATTCTGCTGAGCCATGGACCACG
TCTTGTCCCTATTTGCCTGGCCAGGCAGTCAACACCCTCATTGTCCCTGTTGAGCACTCGTTTCGCAAGCGCAGC
GCATCTCTGAATTCCATGCGCGAGGAGAGTTTTAGAACCATGGACCCAAACGCCAAGTTTACAAAGCCTCAACCC
CTTCCCACCTTGATGGCCGAAACTTCCCGACGCCGCTTAGATACCGCTACTCCCATTTTTCACACCCGTCCTGCA
CTTTGTCCACCGTCCCCAATTTCCTTGTGGAGACGATTATTTGGCCGCCGGCAATCAAACCAAACCCCAACCCCA
ACCCGCGATGCCCAAACCAAGCTTGCGCCTCCTACCGAGATGGATCAAATGCGTGGACTTACTTCCTCGGACTGC
AGCATTTCAGGACTGCCATCTTGTGAACCAATGCAACAGTTGCCTTCTCAGCATATCGCTGGTGCTTTGCAGCCT
CGTTGTAGCAGAGAACCCGTCCTGAGCATCCCCGAAGATATTGTTGAGGAAGTCCATGACCAAGTCCCTTCTCTT
GGCCCGGCCGCCCCGCAACGGGCTGGCCAGGCAGCGAGTTTACCGCACAACTCGGCCCAGGTTGAAGGCTTTGGC
TCCGCAAAGACTGTCTCCAAGGTTGCCTGCTCTCCTTCAATTAGTTCGAGCATTCTCACGTCGTCGGTGTCTCCG
ACGTTGGGCGAGGACGAACCTCCATCATTTTACGACTCCAATGATGACGACGAGGTATTGTCGAGTAACGACGGC
GATAATTATCCACACCAGTCCCTGCCAAGCCTTTGTGCCCCAGGATATGGATTTGCCGGGTACAGCCTCCCTCGA
CAGACGGACTACACCAAGGGCATGACTTCTAGTCCGCCCATGCAAGCATTTGGTTCACCACGTCTTGTGGCTAGG
AACGAGGCTACAGTGCCAATGAGTGGCACTAACCTACTGGCTACGACGATTGACAGTGACCTGGACGATTTTGTC
CATGAAATGGGCTGGATGGTTGGTGTCATTGGCAACAAGCAGGCATAA
Transcript >OphauG2|1502
ATGGATCCCACGACTACCCTCATCACCTTCTTGCTCCAAACGGACCCTACAGTTCAAACTGTTGAGCTCATTGGC
TCATGGGACAATTTTTCATCATGTTATGCCATGAAGCGAGACGTGAGGCGCGGCCAGGGACAATGGAGAGGATGC
TACTCCTTCAAGAATATTGTTTGCGACGACAACAATGCTCTCAAACGGACAAAAAGAAATGGCGGTCTCAAAATG
GGCGCCACTTACTACTACTATTATGAGATAGACGGCTCCATTGAGACATATGATTCTGCTGAGCCATGGACCACG
TCTTGTCCCTATTTGCCTGGCCAGGCAGTCAACACCCTCATTGTCCCTGTTGAGCACTCGTTTCGCAAGCGCAGC
GCATCTCTGAATTCCATGCGCGAGGAGAGTTTTAGAACCATGGACCCAAACGCCAAGTTTACAAAGCCTCAACCC
CTTCCCACCTTGATGGCCGAAACTTCCCGACGCCGCTTAGATACCGCTACTCCCATTTTTCACACCCGTCCTGCA
CTTTGTCCACCGTCCCCAATTTCCTTGTGGAGACGATTATTTGGCCGCCGGCAATCAAACCAAACCCCAACCCCA
ACCCGCGATGCCCAAACCAAGCTTGCGCCTCCTACCGAGATGGATCAAATGCGTGGACTTACTTCCTCGGACTGC
AGCATTTCAGGACTGCCATCTTGTGAACCAATGCAACAGTTGCCTTCTCAGCATATCGCTGGTGCTTTGCAGCCT
CGTTGTAGCAGAGAACCCGTCCTGAGCATCCCCGAAGATATTGTTGAGGAAGTCCATGACCAAGTCCCTTCTCTT
GGCCCGGCCGCCCCGCAACGGGCTGGCCAGGCAGCGAGTTTACCGCACAACTCGGCCCAGGTTGAAGGCTTTGGC
TCCGCAAAGACTGTCTCCAAGGTTGCCTGCTCTCCTTCAATTAGTTCGAGCATTCTCACGTCGTCGGTGTCTCCG
ACGTTGGGCGAGGACGAACCTCCATCATTTTACGACTCCAATGATGACGACGAGGTATTGTCGAGTAACGACGGC
GATAATTATCCACACCAGTCCCTGCCAAGCCTTTGTGCCCCAGGATATGGATTTGCCGGGTACAGCCTCCCTCGA
CAGACGGACTACACCAAGGGCATGACTTCTAGTCCGCCCATGCAAGCATTTGGTTCACCACGTCTTGTGGCTAGG
AACGAGGCTACAGTGCCAATGAGTGGCACTAACCTACTGGCTACGACGATTGACAGTGACCTGGACGATTTTGTC
CATGAAATGGGCTGGATGGTTGGTGTCATTGGCAACAAGCAGGCATAA
Gene >OphauG2|1502
ATGGATCCCACGACTACCCTCATCACCTTCTTGCTGTAAGTCGATGCTCTCCCATTCTCACCATGATCAATCAAG
ACAAATCTTGAGACTGCCTCGATCCCAACCATGTCTTGTTGCGCTTCATTACTCTCCCACCCCAATTGAATTGCC
ACTTGATCGTCAAAGTCGTTGCTATAATGCCATGCCGCGGCAATAAGAAGCTTCTTCCCCACATTTGCCCCCTTT
TTCCAGAAATCTAGCTAGCCCACTACATGAATGCAACACATGACAGCAGCTAACACTCTTGTCTAGCCAAACGGA
CCCTACAGTTCAAACTGTTGAGCTCATTGGCTCATGGGACAATTTTTCATCATGTTATGCCATGAAGCGAGACGT
GAGGCGCGGCCAGGGACAATGGAGAGGATGCTACTCCTTCAAGAATATTGTTTGCGACGACAACAATGCTCTCAA
ACGGACAAAAAGAAATGGCGGTCTCAAAATGGGCGCCACTTACTACTACTATGTAGGCTCGACTGGCTGCCGTCA
AGGTCGCTCTTGTTTTGCTAACCAATTATACTAGTATGAGATAGACGGCTCCATTGAGACATATGATTCTGCTGA
GCCATGGACCACGTCTTGTCCCTATTTGCCTGGCCAGGCAGTCAACACCCTCATTGTCCCTGTTGAGCACTCGTT
TCGCAAGCGCAGCGCATCTCTGAATTCCATGCGCGAGGAGAGTTTTAGAACCATGGACCCAAACGCCAAGTTTAC
AAAGCCTCAACCCCTTCCCACCTTGATGGCCGAAACTTCCCGACGCCGCTTAGATACCGCTACTCCCATTTTTCA
CACCCGTCCTGCACTTTGTCCACCGTCCCCAATTTCCTTGTGGAGACGATTATTTGGCCGCCGGCAATCAAACCA
AACCCCAACCCCAACCCGCGATGCCCAAACCAAGCTTGCGCCTCCTACCGAGATGGATCAAATGCGTGGACTTAC
TTCCTCGGACTGCAGCATTTCAGGACTGCCATCTTGTGAACCAATGCAACAGTTGCCTTCTCAGCATATCGCTGG
TGCTTTGCAGCCTCGTTGTAGCAGAGAACCCGTCCTGAGCATCCCCGAAGATATTGTTGAGGAAGTCCATGACCA
AGTCCCTTCTCTTGGCCCGGCCGCCCCGCAACGGGCTGGCCAGGCAGCGAGTTTACCGCACAACTCGGCCCAGGT
TGAAGGCTTTGGCTCCGCAAAGACTGTCTCCAAGGTTGCCTGCTCTCCTTCAATTAGTTCGAGCATTCTCACGTC
GTCGGTGTCTCCGACGTTGGGCGAGGACGAACCTCCATCATTTTACGACTCCAATGATGACGACGAGGTATTGTC
GAGTAACGACGGCGATAATTATCCACACCAGTCCCTGCCAAGCCTTTGTGCCCCAGGATATGGATTTGCCGGGTA
CAGCCTCCCTCGACAGACGGACTACACCAAGGGCATGACTTCTAGTCCGCCCATGCAAGCATTTGGTTCACCACG
TCTTGTGGCTAGGAACGAGGCTACAGTGCCAATGAGTGGCACTAACCTACTGGCTACGACGATTGACAGTGACCT
GGACGATTTTGTCCATGAAATGGGCTGGATGGTTGGTGTCATTGGCAACAAGCAGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail