Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1499
Gene name
LocationContig_1452:450..3368
Strand+
Gene length (bp)2918
Transcript length (bp)2865
Coding sequence length (bp)2865
Protein length (aa) 955

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04811 Sec23_trunk Sec23/Sec24 trunk domain 4.8E-69 350 591
PF04815 Sec23_helical Sec23/Sec24 helical domain 5.4E-23 691 792
PF08033 Sec23_BS Sec23/Sec24 beta-sandwich domain 2.5E-17 597 680
PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger 1.2E-16 276 313
PF00626 Gelsolin Gelsolin repeat 4.8E-09 820 890

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CLE0|SEC24_KLULA Protein transport protein SEC24 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC24 PE=3 SV=1 178 953 0.0E+00
sp|P0CR41|SEC24_CRYNB Protein transport protein SEC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC24 PE=3 SV=1 216 953 0.0E+00
sp|A3LRW3|SEC24_PICST Protein transport protein SEC24 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC24 PE=3 SV=2 177 953 0.0E+00
sp|Q75B16|SEC24_ASHGO Protein transport protein SEC24 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC24 PE=3 SV=1 89 952 0.0E+00
sp|A5DSK2|SEC24_LODEL Protein transport protein SEC24 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC24 PE=3 SV=1 136 953 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CLE0|SEC24_KLULA Protein transport protein SEC24 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC24 PE=3 SV=1 178 953 0.0E+00
sp|P0CR41|SEC24_CRYNB Protein transport protein SEC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC24 PE=3 SV=1 216 953 0.0E+00
sp|A3LRW3|SEC24_PICST Protein transport protein SEC24 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC24 PE=3 SV=2 177 953 0.0E+00
sp|Q75B16|SEC24_ASHGO Protein transport protein SEC24 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC24 PE=3 SV=1 89 952 0.0E+00
sp|A5DSK2|SEC24_LODEL Protein transport protein SEC24 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC24 PE=3 SV=1 136 953 0.0E+00
sp|Q5AQ76|SEC24_CANAL Protein transport protein SEC24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC24 PE=3 SV=1 176 953 0.0E+00
sp|A5DPC0|SEC24_PICGU Protein transport protein SEC24 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC24 PE=3 SV=2 183 954 0.0E+00
sp|Q6FWD3|SC242_CANGA Protein transport protein SEC24-2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC242 PE=3 SV=1 153 953 0.0E+00
sp|Q875Q0|SEC24_LACK1 Protein transport protein SEC24 (Fragment) OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SEC24 PE=3 SV=1 157 936 0.0E+00
sp|A4QUL1|SEC24_MAGO7 Protein transport protein SEC24 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC24 PE=3 SV=1 15 954 0.0E+00
sp|Q876F5|SC242_SACU7 Protein transport protein SEC24-2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=SEC242 PE=3 SV=1 77 953 0.0E+00
sp|P40482|SEC24_YEAST Protein transport protein SEC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC24 PE=1 SV=1 77 953 0.0E+00
sp|P53953|SFB2_YEAST SED5-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFB2 PE=1 SV=1 159 953 0.0E+00
sp|Q6FX11|SC241_CANGA Protein transport protein SEC24-1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC241 PE=3 SV=1 184 953 0.0E+00
sp|Q876F4|SC241_SACU7 Protein transport protein SEC24-1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=SEC241 PE=3 SV=1 185 953 0.0E+00
sp|Q875V8|SC241_NAUCC Protein transport protein SEC24-1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SEC241 PE=3 SV=1 171 952 0.0E+00
sp|Q875V7|SC242_NAUCC Protein transport protein SEC24-2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SEC242 PE=3 SV=1 81 953 0.0E+00
sp|P0CR40|SEC24_CRYNJ Protein transport protein SEC24 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC24 PE=3 SV=1 216 953 0.0E+00
sp|Q2HH63|SEC24_CHAGB Protein transport protein SEC24 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC24 PE=3 SV=1 32 953 0.0E+00
sp|Q7S4P3|SEC24_NEUCR Protein transport protein sec24 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec24 PE=3 SV=1 4 953 0.0E+00
sp|Q86ZK8|SEC24_PODAS Protein transport protein SEC24 OS=Podospora anserina GN=SEC24 PE=3 SV=1 1 953 0.0E+00
sp|A1DP06|SEC24_NEOFI Protein transport protein SEC24 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec24 PE=3 SV=1 1 953 0.0E+00
sp|A1CUC3|SEC24_ASPCL Protein transport protein sec24 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec24 PE=3 SV=1 13 953 0.0E+00
sp|Q4WLP1|SEC24_ASPFU Protein transport protein sec24 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec24 PE=3 SV=2 4 953 0.0E+00
sp|Q1E6U9|SEC24_COCIM Protein transport protein SEC24 OS=Coccidioides immitis (strain RS) GN=SEC24 PE=3 SV=2 34 953 0.0E+00
sp|Q5B6W0|SEC24_EMENI Protein transport protein sec24 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec24 PE=3 SV=1 13 953 0.0E+00
sp|A2QSG6|SEC24_ASPNC Protein transport protein sec24 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec24 PE=3 SV=1 34 953 0.0E+00
sp|Q0CSL7|SEC24_ASPTN Protein transport protein sec24 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec24 PE=3 SV=1 133 953 0.0E+00
sp|Q6C2T4|SEC24_YARLI Protein transport protein SEC24 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC24 PE=3 SV=1 68 953 0.0E+00
sp|Q9UUI5|SEC24_SCHPO Protein transport protein sec24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec24 PE=2 SV=1 141 953 0.0E+00
sp|Q0PVD8|SEC24_PICPA Protein transport protein SEC24 OS=Komagataella pastoris GN=SEC24 PE=3 SV=1 35 953 0.0E+00
sp|Q4P9K4|SEC24_USTMA Protein transport protein SEC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC24 PE=3 SV=1 199 953 0.0E+00
sp|Q6BT80|SEC24_DEBHA Protein transport protein SEC24 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC24 PE=3 SV=2 170 953 0.0E+00
sp|Q2ULI0|SEC24_ASPOR Protein transport protein sec24 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec24 PE=3 SV=1 1 953 0.0E+00
sp|O95487|SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens GN=SEC24B PE=1 SV=2 150 954 8.0E-165
sp|Q3U2P1|SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus GN=Sec24a PE=1 SV=1 224 953 5.0E-163
sp|A6QNT8|SC24A_BOVIN Protein transport protein Sec24A OS=Bos taurus GN=SEC24A PE=2 SV=1 224 953 6.0E-160
sp|O95486|SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens GN=SEC24A PE=1 SV=2 224 953 9.0E-159
sp|Q9SFU0|SC24A_ARATH Protein transport protein Sec24-like At3g07100 OS=Arabidopsis thaliana GN=At3g07100 PE=2 SV=2 224 953 5.0E-151
sp|Q54U61|SEC24_DICDI Protein transport protein SEC24 OS=Dictyostelium discoideum GN=sec24 PE=3 SV=1 225 953 3.0E-137
sp|O94855|SC24D_HUMAN Protein transport protein Sec24D OS=Homo sapiens GN=SEC24D PE=1 SV=2 109 954 2.0E-115
sp|Q9M291|SC24C_ARATH Protein transport protein Sec24-like CEF OS=Arabidopsis thaliana GN=CEF PE=2 SV=3 151 953 4.0E-115
sp|P53992|SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens GN=SEC24C PE=1 SV=3 223 936 1.0E-106
sp|Q9M081|SC24B_ARATH Protein transport protein Sec24-like At4g32640 OS=Arabidopsis thaliana GN=At4g32640 PE=2 SV=3 223 946 4.0E-105
sp|Q9USS7|YNB3_SCHPO Uncharacterized protein C4.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4.03c PE=2 SV=1 223 897 6.0E-96
sp|P38810|SFB3_YEAST SED5-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFB3 PE=1 SV=1 207 953 1.0E-59
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0030127 COPII vesicle coat Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0006886 intracellular protein transport Yes
GO:0030120 vesicle coat No
GO:0098796 membrane protein complex No
GO:0051179 localization No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0015031 protein transport No
GO:0051234 establishment of localization No
GO:0016192 vesicle-mediated transport No
GO:0048193 Golgi vesicle transport No
GO:0008150 biological_process No
GO:0008104 protein localization No
GO:0071705 nitrogen compound transport No
GO:0032991 protein-containing complex No
GO:0030117 membrane coat No
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0046907 intracellular transport No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0033036 macromolecule localization No
GO:0043169 cation binding No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5228
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1499 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5150
Ophiocordyceps camponoti-floridani Ophcf2|03236
Ophiocordyceps camponoti-rufipedis Ophun1|4860
Ophiocordyceps kimflemingae Ophio5|82
Ophiocordyceps subramaniannii Hirsu2|4271

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1499
MSAPVGDGLGHVPGQQQPEQPLDGVSAAAAPAKKKKRGYAAEAFEVGTGANASMTGQMPSTPGTVPYGYSSVHQA
APQQQGQYPGLSAPDAQQAGSVYGQAFASHQAAFPGQVQPQQQPPQQQQQHLQTAHGGAYPQPDQSYPLPAGAGF
PGVAGITQGMGSMQLGGHGHPQQPPSNMPRATPLNQLYPTDLMNQPFAVSELDLPPPPIILPPNTSVTPSPAANC
PSRYIRSTLNAVPTTNSLLKKSKLPFALIVQPYGSLHDNEDDIPVIQDQVISRCRRCRTYINPFVTFLDQGHRWR
CNMCNLSNDVPSAFDWDTAAQQTVDRWQRHELNYAVVEFVAPQEYMVRPPQPLVYLFLFDVSYAAVSNGLLATSA
RTILDSLNRIPNADRRTRLGFLAVDASLHYFSIPKDEDETAETSMLVVSDLDEPFLPVPHDLLVPLSESRQSIES
FLQKLPDMFHNNQSNGSCMGSALRAGHKLISALGGKIVVLTASLPNIGAGKLDMREDKKLLGTSKEGSLLQTGSS
FYKSFAVECSKSQVSIDMFLFSSQYQDVASLSNLPRYTGGQTWFYPGWHASRPEDALKFASELSDYLSSEIGLEA
VLRVRATTGLRMSAFYGNFFNRSSDLCAFPAFPRDQCYVVEVTMDENMTKNTVCLQAAVLHTTCNGERRIRVLTL
CLPTTTSLSDVYASADQCAITTYFSHKAIERTLSSGLEAARDALQAKLTELLQTFKKELAGGSMGAGLQFPANLR
GLPSLFLGLVKNVGLRKSAQIPSDIRSAALCLLSTLPVPLLMRFIYPRLYSLHDMPDNAGIPDEETGQIVLPSPL
NLTSERFVSYGLYLIDDGQTQFLWIGRDAVPQLISDVFGVEDRTQVHVGKGRVPELDNDFNERVRAVIQKSRDHR
SLGVGSITVPHLYIVREDGEPSLKLWAQTLLVEDRADQSVSSAQWLGVLREKVC*
Coding >OphauG2|1499
ATGTCAGCCCCCGTTGGCGATGGGCTCGGCCATGTGCCTGGCCAACAGCAGCCAGAGCAGCCGTTGGATGGCGTC
TCTGCCGCCGCTGCTCCGGCAAAGAAGAAGAAGCGGGGATATGCTGCCGAGGCTTTTGAAGTTGGTACTGGTGCC
AACGCTTCAATGACTGGCCAGATGCCTTCCACACCTGGCACTGTCCCCTATGGCTACTCGTCTGTACATCAAGCA
GCGCCACAGCAGCAAGGACAATATCCCGGCCTCTCGGCGCCGGATGCTCAGCAGGCTGGAAGTGTCTATGGTCAG
GCCTTCGCCTCGCATCAAGCTGCCTTCCCTGGCCAAGTCCAGCCCCAGCAGCAGCCCCCCCAGCAGCAGCAGCAG
CATCTCCAGACTGCCCACGGGGGCGCCTATCCGCAACCCGATCAGTCCTATCCGCTGCCCGCCGGTGCCGGCTTC
CCCGGTGTCGCTGGCATCACCCAGGGCATGGGCAGTATGCAACTTGGCGGCCATGGCCACCCCCAACAACCCCCA
TCAAACATGCCCCGAGCCACCCCTTTGAATCAACTCTATCCAACCGACCTCATGAACCAGCCCTTTGCCGTATCG
GAGCTCGATTTGCCTCCACCCCCCATTATCCTCCCACCAAATACGAGTGTGACCCCTTCGCCAGCTGCAAATTGC
CCTTCGCGTTACATACGGTCAACTCTCAATGCTGTTCCAACCACAAACTCACTGCTCAAAAAGTCCAAGTTACCC
TTTGCCCTCATTGTTCAGCCTTACGGCTCCCTGCACGACAACGAGGATGACATACCTGTCATTCAGGACCAAGTC
ATATCACGCTGTCGCCGCTGCAGGACCTACATTAATCCCTTTGTTACCTTTTTGGACCAAGGCCACCGCTGGAGA
TGTAACATGTGCAATCTGAGTAATGACGTTCCCTCAGCCTTTGATTGGGATACAGCAGCTCAACAAACGGTTGAT
CGCTGGCAGCGACATGAGCTGAATTATGCTGTAGTGGAGTTTGTCGCCCCTCAGGAGTACATGGTTCGCCCCCCG
CAGCCTCTGGTCTACCTTTTTCTATTCGATGTGAGCTACGCGGCCGTGTCCAACGGTCTGCTGGCCACGAGCGCA
CGCACTATACTCGACAGCCTCAATCGGATACCAAATGCCGACCGTCGCACACGACTCGGATTCTTGGCCGTCGAT
GCCAGCTTGCACTATTTCTCAATTCCCAAGGACGAAGATGAAACGGCTGAAACTAGTATGCTCGTCGTCAGCGAT
CTTGACGAGCCCTTTTTGCCTGTGCCTCACGACCTTCTGGTTCCTTTGAGCGAGAGTCGCCAAAGCATAGAAAGC
TTCTTACAGAAGCTTCCCGATATGTTTCATAACAACCAGAGCAATGGCTCATGTATGGGCTCAGCTCTGCGCGCC
GGCCATAAGCTCATATCAGCTCTCGGTGGCAAAATTGTCGTTCTCACTGCATCTCTTCCCAACATTGGAGCTGGC
AAGTTGGACATGAGAGAGGATAAAAAACTCCTGGGTACTTCCAAGGAAGGCAGTCTTTTACAGACTGGAAGCAGC
TTCTACAAGAGCTTCGCTGTCGAATGTTCCAAAAGCCAAGTTTCGATCGACATGTTTCTCTTTTCCTCCCAGTAT
CAGGACGTTGCATCTCTCAGCAATCTGCCAAGATATACAGGCGGCCAAACTTGGTTCTACCCAGGCTGGCACGCA
TCTCGACCCGAAGACGCCCTCAAGTTTGCTTCCGAGTTGAGCGACTACTTGTCATCTGAAATTGGGCTGGAAGCT
GTGCTGCGCGTACGTGCTACGACTGGCCTACGCATGAGCGCCTTTTATGGCAACTTTTTCAATCGCAGCTCCGAT
CTCTGCGCCTTTCCAGCCTTTCCCCGAGATCAGTGCTACGTGGTCGAGGTGACCATGGATGAAAACATGACAAAA
AACACTGTCTGTCTCCAAGCAGCTGTGCTACACACGACATGTAATGGTGAGCGCCGCATCCGGGTTCTCACCTTG
TGCCTACCGACAACGACAAGCCTGTCAGATGTCTATGCGTCGGCAGATCAATGTGCCATCACTACATATTTCAGT
CACAAGGCTATAGAGAGGACTTTGAGTAGTGGCTTGGAGGCTGCGCGCGACGCTCTTCAGGCAAAACTTACCGAA
CTGCTCCAAACCTTCAAAAAAGAGCTGGCTGGTGGGAGCATGGGCGCCGGCTTACAGTTTCCTGCCAATCTTCGC
GGCCTGCCGTCTCTCTTTCTAGGCTTGGTAAAGAACGTTGGGTTACGCAAATCGGCGCAAATTCCTTCAGACATA
CGCTCAGCCGCTCTCTGCCTCCTTTCAACGCTACCCGTACCGCTATTGATGCGTTTTATCTATCCTCGCCTCTAC
TCCTTACATGACATGCCGGACAATGCCGGTATCCCGGACGAGGAAACAGGACAGATCGTCCTGCCATCGCCCCTT
AATTTGACATCGGAGCGTTTTGTATCGTATGGACTGTACTTGATTGACGATGGACAGACGCAGTTCTTGTGGATT
GGCCGCGATGCGGTGCCTCAGCTTATATCCGACGTATTTGGTGTCGAGGACAGAACCCAGGTGCATGTGGGCAAA
GGGCGGGTTCCCGAACTCGACAACGATTTCAATGAACGAGTCAGAGCCGTCATACAAAAAAGCCGTGACCACCGA
TCCCTTGGCGTTGGCAGCATTACAGTTCCACACCTATATATTGTACGCGAAGATGGAGAGCCGAGCCTGAAGCTC
TGGGCGCAAACACTTTTGGTGGAGGATCGGGCTGACCAGAGTGTAAGCTCTGCCCAGTGGCTAGGTGTATTGAGA
GAAAAGGTCTGTTGA
Transcript >OphauG2|1499
ATGTCAGCCCCCGTTGGCGATGGGCTCGGCCATGTGCCTGGCCAACAGCAGCCAGAGCAGCCGTTGGATGGCGTC
TCTGCCGCCGCTGCTCCGGCAAAGAAGAAGAAGCGGGGATATGCTGCCGAGGCTTTTGAAGTTGGTACTGGTGCC
AACGCTTCAATGACTGGCCAGATGCCTTCCACACCTGGCACTGTCCCCTATGGCTACTCGTCTGTACATCAAGCA
GCGCCACAGCAGCAAGGACAATATCCCGGCCTCTCGGCGCCGGATGCTCAGCAGGCTGGAAGTGTCTATGGTCAG
GCCTTCGCCTCGCATCAAGCTGCCTTCCCTGGCCAAGTCCAGCCCCAGCAGCAGCCCCCCCAGCAGCAGCAGCAG
CATCTCCAGACTGCCCACGGGGGCGCCTATCCGCAACCCGATCAGTCCTATCCGCTGCCCGCCGGTGCCGGCTTC
CCCGGTGTCGCTGGCATCACCCAGGGCATGGGCAGTATGCAACTTGGCGGCCATGGCCACCCCCAACAACCCCCA
TCAAACATGCCCCGAGCCACCCCTTTGAATCAACTCTATCCAACCGACCTCATGAACCAGCCCTTTGCCGTATCG
GAGCTCGATTTGCCTCCACCCCCCATTATCCTCCCACCAAATACGAGTGTGACCCCTTCGCCAGCTGCAAATTGC
CCTTCGCGTTACATACGGTCAACTCTCAATGCTGTTCCAACCACAAACTCACTGCTCAAAAAGTCCAAGTTACCC
TTTGCCCTCATTGTTCAGCCTTACGGCTCCCTGCACGACAACGAGGATGACATACCTGTCATTCAGGACCAAGTC
ATATCACGCTGTCGCCGCTGCAGGACCTACATTAATCCCTTTGTTACCTTTTTGGACCAAGGCCACCGCTGGAGA
TGTAACATGTGCAATCTGAGTAATGACGTTCCCTCAGCCTTTGATTGGGATACAGCAGCTCAACAAACGGTTGAT
CGCTGGCAGCGACATGAGCTGAATTATGCTGTAGTGGAGTTTGTCGCCCCTCAGGAGTACATGGTTCGCCCCCCG
CAGCCTCTGGTCTACCTTTTTCTATTCGATGTGAGCTACGCGGCCGTGTCCAACGGTCTGCTGGCCACGAGCGCA
CGCACTATACTCGACAGCCTCAATCGGATACCAAATGCCGACCGTCGCACACGACTCGGATTCTTGGCCGTCGAT
GCCAGCTTGCACTATTTCTCAATTCCCAAGGACGAAGATGAAACGGCTGAAACTAGTATGCTCGTCGTCAGCGAT
CTTGACGAGCCCTTTTTGCCTGTGCCTCACGACCTTCTGGTTCCTTTGAGCGAGAGTCGCCAAAGCATAGAAAGC
TTCTTACAGAAGCTTCCCGATATGTTTCATAACAACCAGAGCAATGGCTCATGTATGGGCTCAGCTCTGCGCGCC
GGCCATAAGCTCATATCAGCTCTCGGTGGCAAAATTGTCGTTCTCACTGCATCTCTTCCCAACATTGGAGCTGGC
AAGTTGGACATGAGAGAGGATAAAAAACTCCTGGGTACTTCCAAGGAAGGCAGTCTTTTACAGACTGGAAGCAGC
TTCTACAAGAGCTTCGCTGTCGAATGTTCCAAAAGCCAAGTTTCGATCGACATGTTTCTCTTTTCCTCCCAGTAT
CAGGACGTTGCATCTCTCAGCAATCTGCCAAGATATACAGGCGGCCAAACTTGGTTCTACCCAGGCTGGCACGCA
TCTCGACCCGAAGACGCCCTCAAGTTTGCTTCCGAGTTGAGCGACTACTTGTCATCTGAAATTGGGCTGGAAGCT
GTGCTGCGCGTACGTGCTACGACTGGCCTACGCATGAGCGCCTTTTATGGCAACTTTTTCAATCGCAGCTCCGAT
CTCTGCGCCTTTCCAGCCTTTCCCCGAGATCAGTGCTACGTGGTCGAGGTGACCATGGATGAAAACATGACAAAA
AACACTGTCTGTCTCCAAGCAGCTGTGCTACACACGACATGTAATGGTGAGCGCCGCATCCGGGTTCTCACCTTG
TGCCTACCGACAACGACAAGCCTGTCAGATGTCTATGCGTCGGCAGATCAATGTGCCATCACTACATATTTCAGT
CACAAGGCTATAGAGAGGACTTTGAGTAGTGGCTTGGAGGCTGCGCGCGACGCTCTTCAGGCAAAACTTACCGAA
CTGCTCCAAACCTTCAAAAAAGAGCTGGCTGGTGGGAGCATGGGCGCCGGCTTACAGTTTCCTGCCAATCTTCGC
GGCCTGCCGTCTCTCTTTCTAGGCTTGGTAAAGAACGTTGGGTTACGCAAATCGGCGCAAATTCCTTCAGACATA
CGCTCAGCCGCTCTCTGCCTCCTTTCAACGCTACCCGTACCGCTATTGATGCGTTTTATCTATCCTCGCCTCTAC
TCCTTACATGACATGCCGGACAATGCCGGTATCCCGGACGAGGAAACAGGACAGATCGTCCTGCCATCGCCCCTT
AATTTGACATCGGAGCGTTTTGTATCGTATGGACTGTACTTGATTGACGATGGACAGACGCAGTTCTTGTGGATT
GGCCGCGATGCGGTGCCTCAGCTTATATCCGACGTATTTGGTGTCGAGGACAGAACCCAGGTGCATGTGGGCAAA
GGGCGGGTTCCCGAACTCGACAACGATTTCAATGAACGAGTCAGAGCCGTCATACAAAAAAGCCGTGACCACCGA
TCCCTTGGCGTTGGCAGCATTACAGTTCCACACCTATATATTGTACGCGAAGATGGAGAGCCGAGCCTGAAGCTC
TGGGCGCAAACACTTTTGGTGGAGGATCGGGCTGACCAGAGTGTAAGCTCTGCCCAGTGGCTAGGTGTATTGAGA
GAAAAGGTCTGTTGA
Gene >OphauG2|1499
ATGTCAGCCCCCGTTGGCGATGGGCTCGGCCATGTGCCTGGCCAACAGCAGCCAGAGCAGCCGTTGGATGGCGTC
TCTGCCGCCGCTGCTCCGGCAAAGAAGAAGAAGCGGGGATATGCTGCCGAGGCTTTTGAAGTTGGTACTGGTGCC
AACGCTTCAATGACTGGCCAGATGCCTTCCACACCTGGCACTGTCCCCTATGGCTACTCGTCTGTACATCAAGCA
GCGCCACAGCAGCAAGGACAATATCCCGGCCTCTCGGCGCCGGATGCTCAGCAGGCTGGAAGTGTCTATGGTCAG
GCCTTCGCCTCGCATCAAGCTGCCTTCCCTGGCCAAGTCCAGCCCCAGCAGCAGCCCCCCCAGCAGCAGCAGCAG
CATCTCCAGACTGCCCACGGGGGCGCCTATCCGCAACCCGATCAGTCCTATCCGCTGCCCGCCGGTGCCGGCTTC
CCCGGTGTCGCTGGCATCACCCAGGGCATGGGCAGTATGCAACTTGGCGGCCATGGCCACCCCCAACAACCCCCA
TCAAACATGCCCCGAGCCACCCCTTTGAATCAACTCTATCCAACCGACCTCATGAACCAGCCCTTTGCCGTATCG
GAGCTCGATTTGCCTCCACCCCCCATTATCCTCCCACCAAATGTGAGTTCTGCTTTTCGTGATTCATCTGGTCCG
CGCCTGTTAACCGCATGCAGACGAGTGTGACCCCTTCGCCAGCTGCAAATTGCCCTTCGCGTTACATACGGTCAA
CTCTCAATGCTGTTCCAACCACAAACTCACTGCTCAAAAAGTCCAAGTTACCCTTTGCCCTCATTGTTCAGCCTT
ACGGCTCCCTGCACGACAACGAGGATGACATACCTGTCATTCAGGACCAAGTCATATCACGCTGTCGCCGCTGCA
GGACCTACATTAATCCCTTTGTTACCTTTTTGGACCAAGGCCACCGCTGGAGATGTAACATGTGCAATCTGAGTA
ATGACGTTCCCTCAGCCTTTGATTGGGATACAGCAGCTCAACAAACGGTTGATCGCTGGCAGCGACATGAGCTGA
ATTATGCTGTAGTGGAGTTTGTCGCCCCTCAGGAGTACATGGTTCGCCCCCCGCAGCCTCTGGTCTACCTTTTTC
TATTCGATGTGAGCTACGCGGCCGTGTCCAACGGTCTGCTGGCCACGAGCGCACGCACTATACTCGACAGCCTCA
ATCGGATACCAAATGCCGACCGTCGCACACGACTCGGATTCTTGGCCGTCGATGCCAGCTTGCACTATTTCTCAA
TTCCCAAGGACGAAGATGAAACGGCTGAAACTAGTATGCTCGTCGTCAGCGATCTTGACGAGCCCTTTTTGCCTG
TGCCTCACGACCTTCTGGTTCCTTTGAGCGAGAGTCGCCAAAGCATAGAAAGCTTCTTACAGAAGCTTCCCGATA
TGTTTCATAACAACCAGAGCAATGGCTCATGTATGGGCTCAGCTCTGCGCGCCGGCCATAAGCTCATATCAGCTC
TCGGTGGCAAAATTGTCGTTCTCACTGCATCTCTTCCCAACATTGGAGCTGGCAAGTTGGACATGAGAGAGGATA
AAAAACTCCTGGGTACTTCCAAGGAAGGCAGTCTTTTACAGACTGGAAGCAGCTTCTACAAGAGCTTCGCTGTCG
AATGTTCCAAAAGCCAAGTTTCGATCGACATGTTTCTCTTTTCCTCCCAGTATCAGGACGTTGCATCTCTCAGCA
ATCTGCCAAGATATACAGGCGGCCAAACTTGGTTCTACCCAGGCTGGCACGCATCTCGACCCGAAGACGCCCTCA
AGTTTGCTTCCGAGTTGAGCGACTACTTGTCATCTGAAATTGGGCTGGAAGCTGTGCTGCGCGTACGTGCTACGA
CTGGCCTACGCATGAGCGCCTTTTATGGCAACTTTTTCAATCGCAGCTCCGATCTCTGCGCCTTTCCAGCCTTTC
CCCGAGATCAGTGCTACGTGGTCGAGGTGACCATGGATGAAAACATGACAAAAAACACTGTCTGTCTCCAAGCAG
CTGTGCTACACACGACATGTAATGGTGAGCGCCGCATCCGGGTTCTCACCTTGTGCCTACCGACAACGACAAGCC
TGTCAGATGTCTATGCGTCGGCAGATCAATGTGCCATCACTACATATTTCAGTCACAAGGCTATAGAGAGGACTT
TGAGTAGTGGCTTGGAGGCTGCGCGCGACGCTCTTCAGGCAAAACTTACCGAACTGCTCCAAACCTTCAAAAAAG
AGCTGGCTGGTGGGAGCATGGGCGCCGGCTTACAGTTTCCTGCCAATCTTCGCGGCCTGCCGTCTCTCTTTCTAG
GCTTGGTAAAGAACGTTGGGTTACGCAAATCGGCGCAAATTCCTTCAGACATACGCTCAGCCGCTCTCTGCCTCC
TTTCAACGCTACCCGTACCGCTATTGATGCGTTTTATCTATCCTCGCCTCTACTCCTTACATGACATGCCGGACA
ATGCCGGTATCCCGGACGAGGAAACAGGACAGATCGTCCTGCCATCGCCCCTTAATTTGACATCGGAGCGTTTTG
TATCGTATGGACTGTACTTGATTGACGATGGACAGACGCAGTTCTTGTGGATTGGCCGCGATGCGGTGCCTCAGC
TTATATCCGACGTATTTGGTGTCGAGGACAGAACCCAGGTGCATGTGGGCAAAGGGCGGGTTCCCGAACTCGACA
ACGATTTCAATGAACGAGTCAGAGCCGTCATACAAAAAAGCCGTGACCACCGATCCCTTGGCGTTGGCAGCATTA
CAGTTCCACACCTATATATTGTACGCGAAGATGGAGAGCCGAGCCTGAAGCTCTGGGCGCAAACACTTTTGGTGG
AGGATCGGGCTGACCAGAGTGTAAGCTCTGCCCAGTGGCTAGGTGTATTGAGAGAAAAGGTCTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail