Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1497
Gene name
LocationContig_1451:278..2180
Strand-
Gene length (bp)1902
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 6.6E-20 125 266
PF08031 BBE Berberine and berberine like 4.7E-10 518 553

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 2 575 7.0E-81
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 30 554 8.0E-62
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 125 563 6.0E-10
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 110 310 2.0E-07
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 86 292 1.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1497
MSLAQLAVLFGLAGSAAATAIYNPQSQQCRNIPGDPGWPSTSDWAKLNQTVNGHLISSVPLASVCHDAPFNNYDA
GQCNDLQSHWNETTLHHINSPAEFLSMYFNNYTCDAFTPRDRPCELGNFPSYVINVTGPADVQAGVRFAREHNIR
LIVKNTGHDYLGKSSGHGSLSLWTHNLKSTQFLGNYTSPQYSGPAMKSGAGVEGFDYYQAVDRSGHRAVGGSCPT
VGVAGGYTQGGGHSMLSSMYGMGADNVLEWEVVTLDGRHLVATPEQHSDLYWAMSGGGGGTYAVAISMTSRIFAD
SIVGGASLTFNDSVVGNEVFWEAITQLHVLLGPFVDEGNSLIYTLAEKQFSSWAWTMPGADEERVEELMQPFLAD
LEHRGIPYEFTPRVAPGFYDHYNHYIGPLPEGFAGYTPFTGSRIIPRHLMTDPERGADVTAVLRNITMTEGYPFL
PCQALNVKNQKHPKNAVLPAWRDAMAICLMSGTWDPRASPEEMAERQDVAANVVQPMIDEATPGGGVYLNEANYL
QHDWQREFYGDNYERLVEVKRRWDPDHLLWGYTTVDSERWYQDSEARLCRTDA*
Coding >OphauG2|1497
ATGTCTCTTGCTCAGTTGGCCGTCTTGTTCGGCCTGGCTGGCTCAGCAGCTGCCACAGCCATCTACAACCCTCAG
AGCCAGCAGTGTCGCAACATTCCGGGCGACCCCGGGTGGCCGTCGACCAGTGACTGGGCCAAGCTCAACCAGACG
GTTAACGGGCACTTGATTTCATCGGTGCCGCTGGCCAGCGTGTGCCACGATGCGCCCTTTAACAACTATGACGCG
GGACAATGCAATGACCTCCAGAGCCACTGGAACGAGACGACGCTCCACCACATCAACTCGCCAGCCGAGTTTCTC
AGCATGTACTTCAACAACTACACTTGCGATGCCTTTACGCCCCGCGACCGTCCCTGTGAGCTGGGCAACTTTCCT
AGCTACGTCATCAACGTGACGGGTCCGGCAGATGTACAGGCTGGAGTACGGTTTGCACGGGAGCACAATATTCGT
CTTATTGTCAAGAATACGGGTCATGACTACCTCGGCAAGTCTTCTGGCCATGGAAGTCTCTCGCTGTGGACGCAC
AACCTCAAGTCGACTCAGTTCCTCGGCAACTACACGTCGCCCCAGTACAGCGGCCCGGCCATGAAGAGCGGCGCG
GGAGTGGAGGGCTTTGACTACTACCAGGCCGTGGACCGAAGCGGCCACCGTGCCGTGGGCGGATCATGCCCAACA
GTAGGGGTTGCTGGCGGGTATACGCAGGGCGGCGGGCACTCGATGCTGTCGAGCATGTACGGCATGGGAGCCGAC
AACGTGCTTGAATGGGAGGTGGTGACGCTGGACGGGCGGCACTTGGTTGCTACGCCTGAGCAGCACTCGGACCTG
TACTGGGCCATGAGCGGCGGCGGCGGCGGGACGTATGCGGTGGCCATTTCCATGACGAGCCGCATCTTTGCGGAT
AGCATCGTTGGCGGAGCATCGCTGACCTTTAACGACTCGGTGGTTGGCAACGAGGTGTTTTGGGAGGCCATTACG
CAGCTGCACGTGCTCCTGGGGCCGTTTGTCGACGAGGGCAACTCTCTGATTTACACGCTGGCGGAAAAGCAGTTT
TCGTCGTGGGCCTGGACCATGCCGGGGGCCGACGAGGAGCGGGTGGAGGAGCTGATGCAGCCGTTCCTGGCGGAC
CTGGAGCACCGCGGCATTCCCTACGAGTTTACGCCGCGGGTTGCGCCCGGCTTCTACGACCACTACAACCATTAC
ATTGGGCCGTTGCCCGAGGGCTTTGCCGGCTATACGCCCTTTACCGGGTCGCGCATCATCCCGCGCCATCTCATG
ACGGATCCTGAGCGCGGCGCCGACGTGACGGCAGTTTTGCGCAACATCACCATGACCGAGGGCTATCCCTTTTTG
CCGTGCCAGGCCTTGAACGTCAAGAACCAGAAGCACCCCAAGAATGCCGTGCTGCCCGCGTGGCGCGATGCCATG
GCCATTTGCCTCATGTCGGGAACATGGGATCCTCGAGCGTCGCCCGAGGAAATGGCTGAGCGCCAAGACGTTGCT
GCCAATGTGGTGCAGCCCATGATTGACGAGGCCACGCCGGGCGGAGGCGTCTATCTCAACGAGGCCAACTACCTG
CAGCACGACTGGCAGCGCGAGTTTTATGGCGACAACTATGAGCGCCTGGTCGAGGTGAAGCGTCGCTGGGACCCT
GATCACTTGCTCTGGGGATACACCACGGTGGACAGCGAGAGGTGGTATCAGGACTCGGAGGCTCGTCTGTGCCGC
ACCGATGCGTAG
Transcript >OphauG2|1497
ATGTCTCTTGCTCAGTTGGCCGTCTTGTTCGGCCTGGCTGGCTCAGCAGCTGCCACAGCCATCTACAACCCTCAG
AGCCAGCAGTGTCGCAACATTCCGGGCGACCCCGGGTGGCCGTCGACCAGTGACTGGGCCAAGCTCAACCAGACG
GTTAACGGGCACTTGATTTCATCGGTGCCGCTGGCCAGCGTGTGCCACGATGCGCCCTTTAACAACTATGACGCG
GGACAATGCAATGACCTCCAGAGCCACTGGAACGAGACGACGCTCCACCACATCAACTCGCCAGCCGAGTTTCTC
AGCATGTACTTCAACAACTACACTTGCGATGCCTTTACGCCCCGCGACCGTCCCTGTGAGCTGGGCAACTTTCCT
AGCTACGTCATCAACGTGACGGGTCCGGCAGATGTACAGGCTGGAGTACGGTTTGCACGGGAGCACAATATTCGT
CTTATTGTCAAGAATACGGGTCATGACTACCTCGGCAAGTCTTCTGGCCATGGAAGTCTCTCGCTGTGGACGCAC
AACCTCAAGTCGACTCAGTTCCTCGGCAACTACACGTCGCCCCAGTACAGCGGCCCGGCCATGAAGAGCGGCGCG
GGAGTGGAGGGCTTTGACTACTACCAGGCCGTGGACCGAAGCGGCCACCGTGCCGTGGGCGGATCATGCCCAACA
GTAGGGGTTGCTGGCGGGTATACGCAGGGCGGCGGGCACTCGATGCTGTCGAGCATGTACGGCATGGGAGCCGAC
AACGTGCTTGAATGGGAGGTGGTGACGCTGGACGGGCGGCACTTGGTTGCTACGCCTGAGCAGCACTCGGACCTG
TACTGGGCCATGAGCGGCGGCGGCGGCGGGACGTATGCGGTGGCCATTTCCATGACGAGCCGCATCTTTGCGGAT
AGCATCGTTGGCGGAGCATCGCTGACCTTTAACGACTCGGTGGTTGGCAACGAGGTGTTTTGGGAGGCCATTACG
CAGCTGCACGTGCTCCTGGGGCCGTTTGTCGACGAGGGCAACTCTCTGATTTACACGCTGGCGGAAAAGCAGTTT
TCGTCGTGGGCCTGGACCATGCCGGGGGCCGACGAGGAGCGGGTGGAGGAGCTGATGCAGCCGTTCCTGGCGGAC
CTGGAGCACCGCGGCATTCCCTACGAGTTTACGCCGCGGGTTGCGCCCGGCTTCTACGACCACTACAACCATTAC
ATTGGGCCGTTGCCCGAGGGCTTTGCCGGCTATACGCCCTTTACCGGGTCGCGCATCATCCCGCGCCATCTCATG
ACGGATCCTGAGCGCGGCGCCGACGTGACGGCAGTTTTGCGCAACATCACCATGACCGAGGGCTATCCCTTTTTG
CCGTGCCAGGCCTTGAACGTCAAGAACCAGAAGCACCCCAAGAATGCCGTGCTGCCCGCGTGGCGCGATGCCATG
GCCATTTGCCTCATGTCGGGAACATGGGATCCTCGAGCGTCGCCCGAGGAAATGGCTGAGCGCCAAGACGTTGCT
GCCAATGTGGTGCAGCCCATGATTGACGAGGCCACGCCGGGCGGAGGCGTCTATCTCAACGAGGCCAACTACCTG
CAGCACGACTGGCAGCGCGAGTTTTATGGCGACAACTATGAGCGCCTGGTCGAGGTGAAGCGTCGCTGGGACCCT
GATCACTTGCTCTGGGGATACACCACGGTGGACAGCGAGAGGTGGTATCAGGACTCGGAGGCTCGTCTGTGCCGC
ACCGATGCGTAG
Gene >OphauG2|1497
ATGTCTCTTGCTCAGTTGGCCGTCTTGTTCGGCCTGGCTGGCTCAGCAGCTGCCACAGCCATCTACAACCCTCAG
AGCCAGCAGTGTCGCAACATTCCGGGCGACCCCGGGTGGCCGTCGACCAGTGACTGGGCCAAGCTCAACCAGACG
GTTAACGGGCACTTGATTTCATCGGTGCCGCTGGCCAGCGTGTGCCACGATGCGCCCTTTAACAACTATGACGCG
GGACAATGCAATGACCTCCAGAGCCACTGGAACGAGACGACGCTCCACCAGTATGTTTTTGATTTTTTTTTTTGA
TTTTTTTGATTTTTTTTGATTTAATCTTCTTGAGCCAGCCCTTGTTCTTCTCAAGAGACTAACCAGTCTGTGCAG
CATCAACTCGCCAGCCGAGTTTCTCAGCATGTACTTCAACAACTACACTTGCGATGCCTTTACGCCCCGCGACCG
TCCCTGTGAGCTGGGCAACTTTCCTAGCTACGTCATCAACGTGACGGGTCCGGCAGATGTACAGGCTGGAGTACG
GTTTGCACGGGAGCACAATATTCGTCTTATTGTCAAGAATACGGGTCATGAGTAAGTTGCGAGGCTGTAAAAGAG
GGGGAAAAAAAAAGTCTTGCTAATGACGGCTTCCATCATAGCTACCTCGGCAAGTCTTCTGGCCATGGAAGTCTC
TCGCTGTGGACGCACAACCTCAAGTCGACTCAGTTCCTCGGCAACTACACGTCGCCCCAGTACAGCGGCCCGGCC
ATGAAGAGCGGCGCGGGAGTGGAGGGCTTTGACTACTACCAGGCCGTGGACCGAAGCGGCCACCGTGCCGTGGGC
GGATCATGCCCAACAGTAGGGGTTGCTGGCGGGTATACGCAGGGCGGCGGGCACTCGATGCTGTCGAGCATGTAC
GGCATGGGAGCCGACAACGTGCTTGAATGGGAGGTGGTGACGCTGGACGGGCGGCACTTGGTTGCTACGCCTGAG
CAGCACTCGGACCTGTACTGGGCCATGAGCGGCGGCGGCGGCGGGACGTATGCGGTGGCCATTTCCATGACGAGC
CGCATCTTTGCGGATAGCATCGTTGGCGGAGCATCGCTGACCTTTAACGACTCGGTGGTTGGCAACGAGGTGTTT
TGGGAGGCCATTACGCAGCTGCACGTGCTCCTGGGGCCGTTTGTCGACGAGGGCAACTCTCTGATTTACACGCTG
GCGGAAAAGCAGTTTTCGTCGTGGGCCTGGACCATGCCGGGGGCCGACGAGGAGCGGGTGGAGGAGCTGATGCAG
CCGTTCCTGGCGGACCTGGAGCACCGCGGCATTCCCTACGAGTTTACGCCGCGGGTTGCGCCCGGCTTCTACGAC
CACTACAACCATTACATTGGGCCGTTGCCCGAGGGCTTTGCCGGCTATACGCCCTTTACCGGGTCGCGCATCATC
CCGCGCCATCTCATGACGGATCCTGAGCGCGGCGCCGACGTGACGGCAGTTTTGCGCAACATCACCATGACCGAG
GGCTATCCCTTTTTGCCGTGCCAGGCCTTGAACGTCAAGAACCAGAAGCACCCCAAGAATGCCGTGCTGCCCGCG
TGGCGCGATGCCATGGCCATTTGCCTCATGTCGGGAACATGGGATCCTCGAGCGTCGCCCGAGGAAATGGCTGAG
CGCCAAGACGTTGCTGCCAATGTGGTGCAGCCCATGATTGACGAGGCCACGCCGGGCGGAGGCGTCTATCTCAAC
GAGGCCAACTACCTGCAGCACGACTGGCAGCGCGAGTTTTATGGCGACAACTATGAGCGCCTGGTCGAGGTGAAG
CGTCGCTGGGACCCTGATCACTTGCTCTGGGGATACACCACGGTGGACAGCGAGAGGTGGTATCAGGACTCGGAG
GCTCGTCTGTGCCGCACCGATGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail