Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1489
Gene name
LocationContig_145:10799..13403
Strand+
Gene length (bp)2604
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12752 SUZ SUZ domain 4.0E-13 352 417
PF01424 R3H R3H domain 2.1E-07 266 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UBL0|ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens GN=ARPP21 PE=1 SV=2 251 478 1.0E-12
sp|Q9DCB4|ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus GN=Arpp21 PE=1 SV=2 253 478 1.0E-11
sp|A0JNC2|R3HD2_BOVIN R3H domain-containing protein 2 OS=Bos taurus GN=R3HDM2 PE=2 SV=1 251 415 2.0E-11
sp|Q15032|R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens GN=R3HDM1 PE=1 SV=3 251 466 3.0E-11
sp|Q80TM6|R3HD2_MOUSE R3H domain-containing protein 2 OS=Mus musculus GN=R3hdm2 PE=1 SV=2 251 414 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UBL0|ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens GN=ARPP21 PE=1 SV=2 251 478 1.0E-12
sp|Q9DCB4|ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus GN=Arpp21 PE=1 SV=2 253 478 1.0E-11
sp|A0JNC2|R3HD2_BOVIN R3H domain-containing protein 2 OS=Bos taurus GN=R3HDM2 PE=2 SV=1 251 415 2.0E-11
sp|Q15032|R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens GN=R3HDM1 PE=1 SV=3 251 466 3.0E-11
sp|Q80TM6|R3HD2_MOUSE R3H domain-containing protein 2 OS=Mus musculus GN=R3hdm2 PE=1 SV=2 251 414 3.0E-11
sp|Q9Y2K5|R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sapiens GN=R3HDM2 PE=1 SV=3 251 329 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1489
MASTQLSPDNSRPSFAKVAAAVSNETVSDKSPTDKPPSQPIMVTPMVVSSASVQPRQLKSEKPSPAPVDRLTASL
NYVKLEPRIPNLVVNGTCCGSALERQRALLSRECGSDESQRCDSSSELGTKPPSLDGKSITSGTTFAMDEKESLR
PDDSASVKAAAEDDDVFSVRGSLIAASRISSDIAVRARGIQLGDMPERRPVQKPLEVPEQGALTPQSPSSDQPPI
VNTTMPLGTDTVSDALNVIYRQAPDEKLLDALASPRDRYYLLRLEKDVIEFVQDSKEPYMDLPPSNSFCRMLTHK
LADYYHMTHSFEPNIGSVRIFRTPFCRVPPSLATMTPQPSVSTSSTPPPAVLPMKIMRRGQPQEIEAVGADVSKP
TSESGSDGKEGKEKQPIPKEKLSREEREEMYKLARERIFGSSDASIQESEAEIDMSRTSSMSATNRANVGKRGKT
GKQRRDDSDSFDSRNQYTPYWGPQQQTWVAQPQGCQFMPAAPGQFESQSQPPYSGPMTSGYGHQPPGFSAATGAA
GPQGPMYNAYCMPQYQAQQPPPPRFPSPMPAYGPSASQTPSSTPQSWQPGYTQPAYQARGPTAPPCHSHNGIPYP
FGQLPANANPHDPKSQHPIPGSYNRNHSFNPMTQSFVPGANGVHATQLPQPPFTAPGSHHSSPQITTSHAAYNGY
QTPAGQPYSGGYNMARQGSSNSIPPYHGPPGAQHALPPTVPSFPQGLPQHTHLPTPPAHIPSRPAVPQGPSQMYS
HLPTYGNPATLPQKPATGV*
Coding >OphauG2|1489
ATGGCCTCTACTCAGCTGTCTCCGGACAATTCACGCCCTTCCTTCGCAAAGGTAGCCGCCGCAGTCTCCAACGAG
ACTGTATCAGACAAATCTCCCACCGACAAGCCACCTAGTCAGCCCATCATGGTTACGCCCATGGTTGTCAGCAGC
GCCTCGGTCCAACCACGACAGCTCAAATCAGAAAAACCAAGCCCCGCTCCAGTGGACCGTTTGACCGCGTCGCTT
AATTATGTGAAACTCGAACCTAGAATCCCCAACCTTGTGGTTAATGGCACATGTTGTGGCTCTGCGTTGGAGCGG
CAACGGGCATTGTTGAGCAGAGAGTGTGGCTCTGATGAATCTCAGAGATGCGACTCGAGCTCTGAGCTGGGAACC
AAGCCCCCAAGCTTGGATGGCAAGAGTATAACGTCTGGAACTACCTTTGCCATGGATGAAAAGGAATCACTCCGC
CCTGATGACAGCGCCAGCGTCAAGGCAGCCGCTGAGGACGACGATGTGTTTTCAGTGCGAGGCTCTTTGATAGCT
GCCTCGCGCATAAGCTCGGATATTGCAGTCAGGGCCCGCGGCATTCAGCTTGGGGACATGCCCGAACGAAGACCT
GTGCAAAAACCCCTTGAAGTTCCGGAGCAGGGCGCTTTGACACCACAGAGCCCCTCTTCCGACCAGCCTCCCATC
GTCAATACCACCATGCCTCTTGGTACAGATACCGTCTCGGATGCCCTTAACGTCATCTATCGACAAGCTCCAGAC
GAGAAACTGCTTGATGCGTTGGCAAGTCCCAGGGACAGGTACTATTTGTTAAGATTAGAAAAGGATGTCATTGAA
TTCGTACAAGACTCAAAGGAACCATACATGGATTTGCCACCCTCAAACTCGTTTTGCAGGATGTTGACGCACAAA
TTGGCCGACTATTACCATATGACGCATTCGTTTGAGCCAAATATTGGCTCTGTCCGTATTTTCAGAACGCCCTTT
TGCCGAGTTCCTCCATCGCTGGCCACCATGACACCGCAACCCAGTGTTTCTACTAGCAGCACGCCGCCTCCTGCT
GTTCTCCCCATGAAAATAATGCGTAGAGGACAGCCCCAAGAAATAGAGGCTGTTGGCGCCGATGTTTCGAAGCCG
ACATCAGAGTCAGGCAGCGACGGCAAGGAAGGGAAAGAGAAGCAGCCCATACCCAAGGAGAAGCTTTCACGGGAA
GAGAGGGAAGAAATGTACAAGTTGGCACGGGAACGCATTTTCGGAAGCTCTGATGCTAGCATACAGGAATCGGAA
GCTGAAATTGACATGTCCCGGACCAGCTCCATGTCGGCTACTAATAGAGCAAACGTTGGGAAACGCGGCAAGACT
GGCAAGCAACGGCGTGATGATTCGGACAGCTTTGACAGCAGAAATCAGTATACCCCTTATTGGGGTCCGCAGCAA
CAGACTTGGGTTGCTCAGCCTCAAGGGTGCCAGTTTATGCCCGCCGCTCCCGGGCAATTTGAGTCTCAGAGTCAA
CCACCATATTCGGGTCCAATGACCTCTGGTTATGGCCACCAACCACCTGGCTTCTCAGCAGCCACAGGAGCTGCT
GGACCACAAGGCCCCATGTATAATGCATATTGCATGCCACAGTATCAGGCGCAACAACCGCCTCCGCCAAGGTTC
CCCAGTCCAATGCCGGCCTATGGTCCATCGGCTTCGCAAACTCCGTCATCTACACCACAATCGTGGCAGCCAGGC
TATACTCAGCCCGCATACCAGGCAAGAGGGCCCACTGCTCCTCCATGCCATTCTCACAACGGAATTCCATATCCG
TTTGGCCAGCTCCCGGCTAATGCGAACCCCCACGATCCAAAGAGCCAACACCCTATACCTGGGAGCTACAATAGG
AACCATTCTTTCAATCCCATGACGCAATCATTCGTCCCCGGCGCAAATGGAGTGCATGCAACTCAACTACCGCAG
CCCCCATTTACCGCCCCAGGATCCCATCACAGCAGCCCACAAATCACAACGTCACACGCTGCTTATAATGGCTAT
CAGACACCGGCTGGCCAGCCATACAGTGGCGGATACAACATGGCTAGGCAAGGCTCTAGTAACTCGATTCCTCCT
TATCATGGGCCCCCTGGTGCTCAGCACGCTCTGCCGCCTACAGTGCCGAGTTTCCCTCAAGGGCTGCCACAACAT
ACCCATCTGCCGACTCCCCCTGCGCACATCCCCAGTCGCCCCGCCGTGCCTCAAGGCCCGAGTCAGATGTACAGT
CACTTACCCACATACGGCAATCCGGCAACGTTGCCACAAAAGCCAGCCACAGGTGTTTAG
Transcript >OphauG2|1489
ATGGCCTCTACTCAGCTGTCTCCGGACAATTCACGCCCTTCCTTCGCAAAGGTAGCCGCCGCAGTCTCCAACGAG
ACTGTATCAGACAAATCTCCCACCGACAAGCCACCTAGTCAGCCCATCATGGTTACGCCCATGGTTGTCAGCAGC
GCCTCGGTCCAACCACGACAGCTCAAATCAGAAAAACCAAGCCCCGCTCCAGTGGACCGTTTGACCGCGTCGCTT
AATTATGTGAAACTCGAACCTAGAATCCCCAACCTTGTGGTTAATGGCACATGTTGTGGCTCTGCGTTGGAGCGG
CAACGGGCATTGTTGAGCAGAGAGTGTGGCTCTGATGAATCTCAGAGATGCGACTCGAGCTCTGAGCTGGGAACC
AAGCCCCCAAGCTTGGATGGCAAGAGTATAACGTCTGGAACTACCTTTGCCATGGATGAAAAGGAATCACTCCGC
CCTGATGACAGCGCCAGCGTCAAGGCAGCCGCTGAGGACGACGATGTGTTTTCAGTGCGAGGCTCTTTGATAGCT
GCCTCGCGCATAAGCTCGGATATTGCAGTCAGGGCCCGCGGCATTCAGCTTGGGGACATGCCCGAACGAAGACCT
GTGCAAAAACCCCTTGAAGTTCCGGAGCAGGGCGCTTTGACACCACAGAGCCCCTCTTCCGACCAGCCTCCCATC
GTCAATACCACCATGCCTCTTGGTACAGATACCGTCTCGGATGCCCTTAACGTCATCTATCGACAAGCTCCAGAC
GAGAAACTGCTTGATGCGTTGGCAAGTCCCAGGGACAGGTACTATTTGTTAAGATTAGAAAAGGATGTCATTGAA
TTCGTACAAGACTCAAAGGAACCATACATGGATTTGCCACCCTCAAACTCGTTTTGCAGGATGTTGACGCACAAA
TTGGCCGACTATTACCATATGACGCATTCGTTTGAGCCAAATATTGGCTCTGTCCGTATTTTCAGAACGCCCTTT
TGCCGAGTTCCTCCATCGCTGGCCACCATGACACCGCAACCCAGTGTTTCTACTAGCAGCACGCCGCCTCCTGCT
GTTCTCCCCATGAAAATAATGCGTAGAGGACAGCCCCAAGAAATAGAGGCTGTTGGCGCCGATGTTTCGAAGCCG
ACATCAGAGTCAGGCAGCGACGGCAAGGAAGGGAAAGAGAAGCAGCCCATACCCAAGGAGAAGCTTTCACGGGAA
GAGAGGGAAGAAATGTACAAGTTGGCACGGGAACGCATTTTCGGAAGCTCTGATGCTAGCATACAGGAATCGGAA
GCTGAAATTGACATGTCCCGGACCAGCTCCATGTCGGCTACTAATAGAGCAAACGTTGGGAAACGCGGCAAGACT
GGCAAGCAACGGCGTGATGATTCGGACAGCTTTGACAGCAGAAATCAGTATACCCCTTATTGGGGTCCGCAGCAA
CAGACTTGGGTTGCTCAGCCTCAAGGGTGCCAGTTTATGCCCGCCGCTCCCGGGCAATTTGAGTCTCAGAGTCAA
CCACCATATTCGGGTCCAATGACCTCTGGTTATGGCCACCAACCACCTGGCTTCTCAGCAGCCACAGGAGCTGCT
GGACCACAAGGCCCCATGTATAATGCATATTGCATGCCACAGTATCAGGCGCAACAACCGCCTCCGCCAAGGTTC
CCCAGTCCAATGCCGGCCTATGGTCCATCGGCTTCGCAAACTCCGTCATCTACACCACAATCGTGGCAGCCAGGC
TATACTCAGCCCGCATACCAGGCAAGAGGGCCCACTGCTCCTCCATGCCATTCTCACAACGGAATTCCATATCCG
TTTGGCCAGCTCCCGGCTAATGCGAACCCCCACGATCCAAAGAGCCAACACCCTATACCTGGGAGCTACAATAGG
AACCATTCTTTCAATCCCATGACGCAATCATTCGTCCCCGGCGCAAATGGAGTGCATGCAACTCAACTACCGCAG
CCCCCATTTACCGCCCCAGGATCCCATCACAGCAGCCCACAAATCACAACGTCACACGCTGCTTATAATGGCTAT
CAGACACCGGCTGGCCAGCCATACAGTGGCGGATACAACATGGCTAGGCAAGGCTCTAGTAACTCGATTCCTCCT
TATCATGGGCCCCCTGGTGCTCAGCACGCTCTGCCGCCTACAGTGCCGAGTTTCCCTCAAGGGCTGCCACAACAT
ACCCATCTGCCGACTCCCCCTGCGCACATCCCCAGTCGCCCCGCCGTGCCTCAAGGCCCGAGTCAGATGTACAGT
CACTTACCCACATACGGCAATCCGGCAACGTTGCCACAAAAGCCAGCCACAGGTGTTTAG
Gene >OphauG2|1489
ATGGCCTCTACTCAGCTGTCTCCGGACAATTCACGCCCTTCCTTCGCAAAGGTATCTCTCCCTTGGCCACCCCTT
TCCTTGTACTAAGATTTGCTTATTCCCCTCCCTCCCTTGAATAGGTAGCCGCCGCAGTCTCCAACGAGACTGTAT
CAGACAAATCTCCCACCGACAAGCCACCTAGTCAGCCCATCATGGTTACGCCCATGGTTGTCAGCAGCGCCTCGG
TCCAACCACGACAGCTCAAATCAGAAAAACCAAGCCCCGCTCCAGTGGACCGTTTGACCGCGTCGCTTAATTATG
TGAAACTCGAACCTAGAATCCCCAACCTTGTGGTTAATGGCACATGTTGTGGCTCTGCGTTGGAGCGGCAACGGG
CATTGTTGAGCAGAGAGTGTGGCTCTGATGAATCTCAGAGATGCGACTCGAGCTCTGAGCTGGGAACCAAGCCCC
CAAGCTTGGATGGCAAGAGTATAACGTCTGGAACTACCTTTGCCATGGATGAAAAGGAATCACTCCGCCCTGATG
ACAGCGCCAGCGTCAAGGCAGCCGCTGAGGACGACGATGTGTTTTCAGTGCGAGGCTCTTTGATAGCTGCCTCGC
GCATAAGCTCGGATATTGCAGTCAGGGCCCGCGGCATTCAGCTTGGGGACATGCCCGAACGAAGACCTGTGCAAA
AACCCCTTGAAGTTCCGGAGCAGGGCGCTTTGACACCACAGAGCCCCTCTTCCGACCAGCCTCCCATCGTCAATA
CCACCATGCCTCTTGGTACAGATACCGTCTCGGATGCCCTTAACGTCATCTATCGACAAGCTCCAGACGAGAAAC
TGCTTGATGCGTTGGCAAGTCCCAGGGACAGGTACTATTTGTTAAGATTAGAAAAGGATGTCATTGAATTCGTAC
AAGACTCAAAGTAAGTACCTGTTTTGTCTATCAAAACACATTCTACATGTGCTCACTTTACCAGGGAACCATACA
TGGATTTGCCACCCTCAAACTCGTTTTGCAGGATGTTGACGCACAAATTGGCCGACTATTACCATATGACGCATT
CGTTTGAGCCAAATATTGGCTCTGTCCGTATTTTCAGAACGCCCTTTTGCCGAGTTCCTCCATCGCTGGCCACCA
TGACACCGCAACCCAGTGTTTCTACTAGCAGCACGCCGCCTCCTGCTGTTCTCCCCATGAAAATAATGCGTAGAG
GACAGCCCCAAGAAATAGAGGCTGTTGGCGCCGATGTTTCGAAGCCGACATCAGAGTCAGGCAGCGACGGCAAGG
AAGGGAAAGAGAAGCAGCCCATACCCAAGGAGAAGTAAGTATTGCCCAACGGAATCAATTTCTAACACACTCTAA
TACCACTGTCTCCAGGCTTTCACGGGAAGAGAGGGAAGAAATGTACAAGTTGGCACGGGAACGCATTTTCGGAAG
CTCTGATGCTAGCATACAGGGTAAAGCATCCGTGCTTGTGTTTAAATGTTGCTTCTAATCTTGATTGGCTAACTT
GCATGCAGAATCGGAAGCTGAAATTGACATGTCCCGGACCAGCTCCATGTCGGCTACTAATAGAGCAAACGTTGG
GAAACGCGGCAAGACTGGCAAGCAACGGCGTGATGATTCGGACAGCTTTGACAGCAGAAATCAGTATACCCCTTA
TTGGGGTCCGCAGCAACAGACTTGGGTTGCTCAGCCTCAAGGGTGCCAGTTTATGCCCGCCGCTCCCGGGCAATT
TGAGTCTCAGAGTCAACCACCATATTCGGGTCCAATGACCTCTGGTTATGGCCACCAACCACCTGGCTTCTCAGC
AGCCACAGGAGCTGCTGGACCACAAGGCCCCATGTATAATGCATATTGCATGCCACAGGTCAGTCAAAGTTAACA
GAGAGTCTAAAGTTAAAGGCTGACGCAAAGAGAAAGTATCAGGCGCAACAACCGCCTCCGCCAAGGTTCCCCAGT
CCAATGCCGGCCTATGGTCCATCGGCTTCGCAAACTCCGTCATCTACACCACAATCGTGGCAGCCAGGCTATACT
CAGCCCGCATACCAGGCAAGAGGGCCCACTGCTCCTCCATGCCATTCTCACAACGGAATTCCATATCCGTTTGGC
CAGCTCCCGGCTAATGCGAACCCCCACGATCCAAAGAGCCAACACCCTATACCTGGGAGCTACAATAGGAACCAT
TCTTTCAATCCCATGACGCAATCATTCGTCCCCGGCGCAAATGGAGTGCATGCAACTCAACTACCGCAGCCCCCA
TTTACCGCCCCAGGATCCCATCACAGCAGCCCACAAATCACAACGTCACACGCTGCTTATAATGGCTATCAGACA
CCGGCTGGCCAGCCATACAGTGGCGGATACAACATGGCTAGGCAAGGCTCTAGTAACTCGATTCCTCCTTATCAT
GGGCCCCCTGGTGCTCAGCACGCTCTGCCGCCTACAGTGCCGAGTTTCCCTCAAGGGCTGCCACAACATACCCAT
CTGCCGACTCCCCCTGCGCACATCCCCAGTCGCCCCGCCGTGCCTCAAGGCCCGAGTCAGATGTACAGTCACTTA
CCCACATACGGCAATCCGGCAACGTTGCCACAAAAGCCAGCCACAGGTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail