Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|148
Gene name
LocationContig_102:27340..30295
Strand+
Gene length (bp)2955
Transcript length (bp)2955
Coding sequence length (bp)2955
Protein length (aa) 985

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00580 UvrD-helicase UvrD/REP helicase N-terminal domain 3.9E-63 15 270
PF13361 UvrD_C UvrD-like helicase C-terminal domain 2.9E-61 277 643
PF13245 AAA_19 AAA domain 1.6E-31 19 255
PF13538 UvrD_C_2 UvrD-like helicase C-terminal domain 6.2E-13 587 641

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10213|SRS2_SCHPO ATP-dependent DNA helicase srs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srs2 PE=1 SV=1 9 691 4.0E-145
sp|Q9S3Q0|PCRA_LEUCI ATP-dependent DNA helicase PcrA OS=Leuconostoc citreum GN=pcrA PE=3 SV=1 15 642 6.0E-99
sp|Q6GFF2|PCRA_STAAR ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MRSA252) GN=pcrA PE=3 SV=1 12 680 4.0E-98
sp|P64319|PCRA_STAAN ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain N315) GN=pcrA PE=1 SV=1 12 680 5.0E-98
sp|P64318|PCRA_STAAM ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pcrA PE=3 SV=1 12 680 5.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10213|SRS2_SCHPO ATP-dependent DNA helicase srs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srs2 PE=1 SV=1 9 691 4.0E-145
sp|Q9S3Q0|PCRA_LEUCI ATP-dependent DNA helicase PcrA OS=Leuconostoc citreum GN=pcrA PE=3 SV=1 15 642 6.0E-99
sp|Q6GFF2|PCRA_STAAR ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MRSA252) GN=pcrA PE=3 SV=1 12 680 4.0E-98
sp|P64319|PCRA_STAAN ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain N315) GN=pcrA PE=1 SV=1 12 680 5.0E-98
sp|P64318|PCRA_STAAM ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pcrA PE=3 SV=1 12 680 5.0E-98
sp|Q8NVT1|PCRA_STAAW ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MW2) GN=pcrA PE=3 SV=1 12 679 6.0E-98
sp|Q6G828|PCRA_STAAS ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain MSSA476) GN=pcrA PE=3 SV=1 12 679 6.0E-98
sp|Q5HEL7|PCRA_STAAC ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain COL) GN=pcrA PE=3 SV=1 12 679 6.0E-98
sp|Q53727|PCRA_STAA8 ATP-dependent DNA helicase PcrA OS=Staphylococcus aureus (strain NCTC 8325) GN=pcrA PE=1 SV=3 12 679 6.0E-98
sp|Q05311|UVRD_SALTY DNA helicase II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=uvrD PE=3 SV=2 8 643 4.0E-94
sp|P03018|UVRD_ECOLI DNA helicase II OS=Escherichia coli (strain K12) GN=uvrD PE=1 SV=1 8 643 4.0E-93
sp|Q5HN29|PCRA_STAEQ ATP-dependent DNA helicase PcrA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pcrA PE=3 SV=1 12 642 4.0E-93
sp|Q8CRT9|PCRA_STAES ATP-dependent DNA helicase PcrA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pcrA PE=3 SV=1 12 642 5.0E-93
sp|P56255|PCRA_GEOSE ATP-dependent DNA helicase PcrA OS=Geobacillus stearothermophilus GN=pcrA PE=1 SV=1 12 642 9.0E-93
sp|O34580|PCRA_BACSU ATP-dependent DNA helicase PcrA OS=Bacillus subtilis (strain 168) GN=pcrA PE=1 SV=1 12 642 5.0E-88
sp|P57654|REP_BUCAI ATP-dependent DNA helicase Rep OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rep PE=3 SV=1 14 676 9.0E-88
sp|P9WMQ1|UVRD1_MYCTU ATP-dependent DNA helicase UvrD1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrD1 PE=1 SV=1 12 642 1.0E-87
sp|P9WMQ0|UVRD1_MYCTO ATP-dependent DNA helicase UvrD1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrD1 PE=3 SV=1 12 642 1.0E-87
sp|P0A5A4|UVRD1_MYCBO ATP-dependent DNA helicase UvrD1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrD1 PE=3 SV=1 12 642 1.0E-87
sp|Q9CD72|UVRD1_MYCLE ATP-dependent DNA helicase UvrD1 OS=Mycobacterium leprae (strain TN) GN=uvrD PE=3 SV=1 2 642 2.0E-85
sp|Q02322|UVRD_HAEIN DNA helicase II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uvrD PE=1 SV=2 8 643 7.0E-84
sp|Q1RIP8|UVRD_RICBR Probable DNA helicase II homolog OS=Rickettsia bellii (strain RML369-C) GN=uvrD PE=3 SV=1 12 642 4.0E-78
sp|P44804|REP_HAEIN ATP-dependent DNA helicase Rep OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rep PE=3 SV=1 15 676 4.0E-78
sp|Q9ZD95|UVRD_RICPR Probable DNA helicase II homolog OS=Rickettsia prowazekii (strain Madrid E) GN=uvrD PE=3 SV=1 12 642 1.0E-77
sp|Q68WT1|UVRD_RICTY DNA helicase II OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=uvrD PE=3 SV=1 12 642 7.0E-77
sp|Q92HZ6|UVRD_RICCN Probable DNA helicase II homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=uvrD PE=3 SV=1 12 642 1.0E-76
sp|P09980|REP_ECOLI ATP-dependent DNA helicase Rep OS=Escherichia coli (strain K12) GN=rep PE=1 SV=3 15 676 9.0E-76
sp|Q4ULN5|UVRD_RICFE Probable DNA helicase II homolog OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=uvrD PE=3 SV=1 12 642 2.0E-75
sp|Q9L6S1|REP_SALTY ATP-dependent DNA helicase Rep OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rep PE=3 SV=1 15 676 3.0E-75
sp|O51889|REP_BUCAP ATP-dependent DNA helicase Rep OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rep PE=3 SV=1 14 676 4.0E-74
sp|Q89A21|REP_BUCBP ATP-dependent DNA helicase Rep OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rep PE=3 SV=1 15 649 1.0E-72
sp|P45612|UVRD_MYCCT Probable DNA helicase II homolog OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=uvrD PE=3 SV=2 22 643 6.0E-71
sp|P12954|SRS2_YEAST ATP-dependent DNA helicase SRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRS2 PE=1 SV=2 1 425 7.0E-64
sp|O31626|YJCD_BACSU Putative ATP-dependent DNA helicase YjcD OS=Bacillus subtilis (strain 168) GN=yjcD PE=1 SV=1 15 667 3.0E-58
sp|D1KF50|SRS2L_ARATH ATP-dependent DNA helicase SRS2-like protein At4g25120 OS=Arabidopsis thaliana GN=SRS2 PE=1 SV=1 14 643 2.0E-52
sp|P75438|Y340_MYCPN Probable DNA helicase MPN_340 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_340 PE=3 SV=1 12 368 5.0E-43
sp|P75437|UVRD_MYCPN Probable DNA helicase II homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=uvrD PE=3 SV=1 15 368 1.0E-33
sp|P47486|UVRD_MYCGE Probable DNA helicase II homolog OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=uvrD PE=3 SV=1 15 358 2.0E-33
sp|P9WMP9|UVRD2_MYCTU ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrD2 PE=1 SV=1 3 493 1.0E-29
sp|P9WMP8|UVRD2_MYCTO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrD2 PE=3 SV=1 3 493 1.0E-29
sp|P64321|UVRD2_MYCBO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrD2 PE=3 SV=1 3 493 1.0E-29
sp|Q12039|HMI1_YEAST ATP-dependent DNA helicase HMI1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMI1 PE=1 SV=1 27 648 2.0E-28
sp|P53528|UVRD2_MYCLE ATP-dependent DNA helicase UvrD2 OS=Mycobacterium leprae (strain TN) GN=uvrD2 PE=3 SV=2 15 443 3.0E-21
sp|B7GM51|ADDA_ANOFW ATP-dependent helicase/nuclease subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=addA PE=3 SV=1 182 664 5.0E-19
sp|A2RH77|ADDA_LACLM ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=addA PE=1 SV=1 177 647 5.0E-18
sp|B1MZM2|ADDA_LEUCK ATP-dependent helicase/nuclease subunit A OS=Leuconostoc citreum (strain KM20) GN=addA PE=3 SV=1 177 641 7.0E-18
sp|P23478|ADDA_BACSU ATP-dependent helicase/nuclease subunit A OS=Bacillus subtilis (strain 168) GN=addA PE=1 SV=2 145 649 9.0E-18
sp|Q04GY7|ADDA_OENOB ATP-dependent helicase/nuclease subunit A OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=addA PE=3 SV=1 190 641 9.0E-18
sp|Q65LJ9|ADDA_BACLD ATP-dependent helicase/nuclease subunit A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=addA PE=3 SV=1 120 641 1.0E-17
sp|Q8E5T9|ADDA_STRA3 ATP-dependent helicase/nuclease subunit A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=addA PE=3 SV=1 179 641 2.0E-17
sp|Q8ERW5|ADDA_OCEIH ATP-dependent helicase/nuclease subunit A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=addA PE=3 SV=1 174 641 3.0E-17
sp|Q033I1|ADDA_LACLS ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=addA PE=3 SV=1 177 647 5.0E-17
sp|P15038|HELD_ECOLI Helicase IV OS=Escherichia coli (strain K12) GN=helD PE=1 SV=2 15 308 8.0E-17
sp|Q3K1I4|ADDA_STRA1 ATP-dependent helicase/nuclease subunit A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=addA PE=3 SV=1 179 641 8.0E-17
sp|Q8E061|ADDA_STRA5 ATP-dependent helicase/nuclease subunit A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=addA PE=3 SV=1 179 641 8.0E-17
sp|B1I493|ADDA_DESAP ATP-dependent helicase/nuclease subunit A OS=Desulforudis audaxviator (strain MP104C) GN=addA PE=3 SV=1 60 656 1.0E-16
sp|B2IPX3|ADDA_STRPS ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain CGSP14) GN=addA PE=3 SV=1 187 641 1.0E-16
sp|B4U2H1|ADDA_STREM ATP-dependent helicase/nuclease subunit A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=addA PE=3 SV=1 174 641 2.0E-16
sp|A8FBR1|ADDA_BACP2 ATP-dependent helicase/nuclease subunit A OS=Bacillus pumilus (strain SAFR-032) GN=addA PE=3 SV=1 144 648 2.0E-16
sp|Q8DPR6|ADDA_STRR6 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=addA PE=3 SV=1 187 641 2.0E-16
sp|Q97QP9|ADDA_STRPN ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=addA PE=3 SV=1 187 641 2.0E-16
sp|Q04KF8|ADDA_STRP2 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=addA PE=3 SV=1 187 641 2.0E-16
sp|Q38X69|ADDA_LACSS ATP-dependent helicase/nuclease subunit A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=addA PE=3 SV=1 181 605 3.0E-16
sp|Q9CJI9|ADDA_LACLA ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=addA PE=3 SV=1 142 641 3.0E-16
sp|C0MGY6|ADDA_STRS7 ATP-dependent helicase/nuclease subunit A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=addA PE=3 SV=1 174 641 5.0E-16
sp|Q03W49|ADDA_LEUMM ATP-dependent helicase/nuclease subunit A OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=addA PE=3 SV=1 190 654 6.0E-16
sp|Q8DT76|ADDA_STRMU ATP-dependent helicase/nuclease subunit A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=addA PE=3 SV=1 180 641 8.0E-16
sp|B1IBR6|ADDA_STRPI ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=addA PE=3 SV=1 187 641 1.0E-15
sp|B5E4P5|ADDA_STRP4 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=addA PE=3 SV=1 187 641 2.0E-15
sp|B8ZQ32|ADDA_STRPJ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=addA PE=3 SV=1 187 641 2.0E-15
sp|B5XKR4|ADDA_STRPZ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=addA PE=3 SV=1 181 641 5.0E-15
sp|Q9A0H3|ADDA_STRP1 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M1 GN=addA PE=3 SV=2 181 641 6.0E-15
sp|P0CZ53|ADDA_STRPQ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=addA PE=3 SV=1 181 641 1.0E-14
sp|P0CZ52|ADDA_STRP3 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=addA PE=3 SV=1 181 641 1.0E-14
sp|Q1JCJ8|ADDA_STRPB ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=addA PE=3 SV=2 181 641 2.0E-14
sp|Q1JMH5|ADDA_STRPC ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=addA PE=3 SV=1 181 641 2.0E-14
sp|Q1J7E4|ADDA_STRPF ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=addA PE=3 SV=1 181 641 2.0E-14
sp|Q5XCW6|ADDA_STRP6 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=addA PE=3 SV=1 181 641 2.0E-14
sp|B7IL84|ADDA_BACC2 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain G9842) GN=addA PE=3 SV=1 174 641 2.0E-14
sp|A7GM37|ADDA_BACCN ATP-dependent helicase/nuclease subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=addA PE=3 SV=1 181 649 2.0E-14
sp|B7JDU4|ADDA_BACC0 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain AH820) GN=addA PE=3 SV=1 174 641 2.0E-14
sp|A2RFA8|ADDA_STRPG ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=addA PE=3 SV=1 181 641 3.0E-14
sp|Q8P1J2|ADDA_STRP8 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=addA PE=3 SV=1 181 641 3.0E-14
sp|A8YVK0|ADDA_LACH4 ATP-dependent helicase/nuclease subunit A OS=Lactobacillus helveticus (strain DPC 4571) GN=addA PE=3 SV=1 173 423 3.0E-14
sp|A8AY33|ADDA_STRGC ATP-dependent helicase/nuclease subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=addA PE=3 SV=1 189 641 3.0E-14
sp|Q1JHM1|ADDA_STRPD ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=addA PE=3 SV=1 181 641 4.0E-14
sp|Q48UB8|ADDA_STRPM ATP-dependent helicase/nuclease subunit A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=addA PE=3 SV=1 181 641 1.0E-13
sp|A0RAX7|ADDA_BACAH ATP-dependent helicase/nuclease subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=addA PE=3 SV=1 174 647 1.0E-13
sp|Q5LY80|ADDA_STRT1 ATP-dependent helicase/nuclease subunit A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=addA PE=3 SV=1 179 641 3.0E-13
sp|B7HGP9|ADDA_BACC4 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain B4264) GN=addA PE=3 SV=1 174 641 3.0E-13
sp|Q04AN7|ADDA_LACDB ATP-dependent helicase/nuclease subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=addA PE=3 SV=1 190 458 4.0E-13
sp|Q5M2T7|ADDA_STRT2 ATP-dependent helicase/nuclease subunit A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=addA PE=3 SV=1 179 641 4.0E-13
sp|Q3AA35|ADDA_CARHZ ATP-dependent helicase/nuclease subunit A OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=addA PE=3 SV=1 174 641 4.0E-13
sp|Q81GP9|ADDA_BACCR ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=addA PE=3 SV=1 174 641 4.0E-13
sp|Q1GAA9|ADDA_LACDA ATP-dependent helicase/nuclease subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=addA PE=3 SV=1 190 458 5.0E-13
sp|Q81TW1|ADDA_BACAN ATP-dependent helicase/nuclease subunit A OS=Bacillus anthracis GN=addA PE=3 SV=1 174 647 5.0E-13
sp|Q63EM2|ADDA_BACCZ ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ZK / E33L) GN=addA PE=3 SV=1 181 647 5.0E-13
sp|Q6GAV9|ADDA_STAAS ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain MSSA476) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|Q6GIC1|ADDA_STAAR ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain MRSA252) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|Q7A6H4|ADDA_STAAN ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain N315) GN=addA PE=1 SV=1 177 641 9.0E-13
sp|Q99VC3|ADDA_STAAM ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|A5IRE5|ADDA_STAA9 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain JH9) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|A6U074|ADDA_STAA2 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain JH1) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|A7X0I2|ADDA_STAA1 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|A8Z073|ADDA_STAAT ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|Q2FIA8|ADDA_STAA3 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain USA300) GN=addA PE=3 SV=1 177 641 9.0E-13
sp|Q5HQJ4|ADDA_STAEQ ATP-dependent helicase/nuclease subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=addA PE=3 SV=1 189 641 1.0E-12
sp|A6QFH8|ADDA_STAAE ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain Newman) GN=addA PE=3 SV=1 177 641 1.0E-12
sp|Q5HHB7|ADDA_STAAC ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain COL) GN=addA PE=3 SV=1 177 641 1.0E-12
sp|Q2FZT5|ADDA_STAA8 ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=addA PE=3 SV=1 177 641 1.0E-12
sp|Q8NXE9|ADDA_STAAW ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain MW2) GN=addA PE=3 SV=1 177 641 1.0E-12
sp|Q8CPT9|ADDA_STAES ATP-dependent helicase/nuclease subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=addA PE=3 SV=1 189 641 2.0E-12
sp|Q03IZ8|ADDA_STRTD ATP-dependent helicase/nuclease subunit A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=addA PE=3 SV=1 179 641 2.0E-12
sp|B2G532|ADDA_LACRJ ATP-dependent helicase/nuclease subunit A OS=Lactobacillus reuteri (strain JCM 1112) GN=addA PE=3 SV=1 212 605 4.0E-12
sp|A5VHK2|ADDA_LACRD ATP-dependent helicase/nuclease subunit A OS=Lactobacillus reuteri (strain DSM 20016) GN=addA PE=3 SV=1 212 605 4.0E-12
sp|Q74JA6|ADDA_LACJO ATP-dependent helicase/nuclease subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=addA PE=3 SV=1 130 423 2.0E-11
sp|P53528|UVRD2_MYCLE ATP-dependent DNA helicase UvrD2 OS=Mycobacterium leprae (strain TN) GN=uvrD2 PE=3 SV=2 469 678 4.0E-11
sp|Q2YWW4|ADDA_STAAB ATP-dependent helicase/nuclease subunit A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=addA PE=3 SV=1 177 641 5.0E-11
sp|Q043G6|ADDA_LACGA ATP-dependent helicase/nuclease subunit A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=addA PE=3 SV=1 139 423 6.0E-11
sp|B9DRV0|ADDA_STRU0 ATP-dependent helicase/nuclease subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=addA PE=3 SV=1 174 641 9.0E-11
sp|A0QS29|RECB_MYCS2 RecBCD enzyme subunit RecB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=recB PE=3 SV=1 28 404 3.0E-10
sp|Q9Z7G7|RECB_CHLPN RecBCD enzyme subunit RecB OS=Chlamydia pneumoniae GN=recB PE=3 SV=2 215 654 9.0E-10
sp|A3CNT9|ADDA_STRSV ATP-dependent helicase/nuclease subunit A OS=Streptococcus sanguinis (strain SK36) GN=addA PE=3 SV=1 19 130 2.0E-09
sp|B7GM51|ADDA_ANOFW ATP-dependent helicase/nuclease subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=addA PE=3 SV=1 16 136 4.0E-09
sp|A3DH19|ADDA_CLOTH ATP-dependent helicase/nuclease subunit A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=addA PE=3 SV=1 17 128 4.0E-09
sp|Q9CJI9|ADDA_LACLA ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=addA PE=3 SV=1 19 136 5.0E-09
sp|Q8DPR6|ADDA_STRR6 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=addA PE=3 SV=1 19 130 6.0E-09
sp|Q97QP9|ADDA_STRPN ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=addA PE=3 SV=1 19 130 6.0E-09
sp|Q04KF8|ADDA_STRP2 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=addA PE=3 SV=1 19 130 6.0E-09
sp|A2RH77|ADDA_LACLM ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=addA PE=1 SV=1 19 136 2.0E-08
sp|Q033I1|ADDA_LACLS ATP-dependent helicase/nuclease subunit A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=addA PE=3 SV=1 19 136 2.0E-08
sp|B5E4P5|ADDA_STRP4 ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=addA PE=3 SV=1 19 130 3.0E-08
sp|B8ZQ32|ADDA_STRPJ ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=addA PE=3 SV=1 19 130 3.0E-08
sp|O84645|RECB_CHLTR RecBCD enzyme subunit RecB OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=recB PE=3 SV=1 193 290 3.0E-08
sp|P9WMP9|UVRD2_MYCTU ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrD2 PE=1 SV=1 587 665 4.0E-08
sp|P9WMP8|UVRD2_MYCTO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrD2 PE=3 SV=1 587 665 4.0E-08
sp|P64321|UVRD2_MYCBO ATP-dependent DNA helicase UvrD2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrD2 PE=3 SV=1 587 665 4.0E-08
sp|B2IPX3|ADDA_STRPS ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain CGSP14) GN=addA PE=3 SV=1 19 130 4.0E-08
sp|Q9PLT8|RECB_CHLMU RecBCD enzyme subunit RecB OS=Chlamydia muridarum (strain MoPn / Nigg) GN=recB PE=3 SV=2 193 290 4.0E-08
sp|Q03D71|ADDA_PEDPA ATP-dependent helicase/nuclease subunit A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=addA PE=3 SV=1 18 146 6.0E-08
sp|B2A610|ADDA_NATTJ ATP-dependent helicase/nuclease subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=addA PE=3 SV=1 17 128 7.0E-08
sp|B1IBR6|ADDA_STRPI ATP-dependent helicase/nuclease subunit A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=addA PE=3 SV=1 19 130 1.0E-07
sp|Q0SWW4|ADDA_CLOPS ATP-dependent helicase/nuclease subunit A OS=Clostridium perfringens (strain SM101 / Type A) GN=addA PE=3 SV=1 17 146 1.0E-07
sp|Q0TV46|ADDA_CLOP1 ATP-dependent helicase/nuclease subunit A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=addA PE=3 SV=1 17 146 1.0E-07
sp|P23478|ADDA_BACSU ATP-dependent helicase/nuclease subunit A OS=Bacillus subtilis (strain 168) GN=addA PE=1 SV=2 14 136 2.0E-07
sp|Q65LJ9|ADDA_BACLD ATP-dependent helicase/nuclease subunit A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=addA PE=3 SV=1 14 136 2.0E-07
sp|A7GM37|ADDA_BACCN ATP-dependent helicase/nuclease subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=addA PE=3 SV=1 19 136 2.0E-07
sp|B9DRV0|ADDA_STRU0 ATP-dependent helicase/nuclease subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=addA PE=3 SV=1 19 196 2.0E-07
sp|A9VJ02|ADDA_BACWK ATP-dependent helicase/nuclease subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=addA PE=3 SV=1 19 136 2.0E-07
sp|Q8XPE2|ADDA_CLOPE ATP-dependent helicase/nuclease subunit A OS=Clostridium perfringens (strain 13 / Type A) GN=addA PE=3 SV=1 17 146 2.0E-07
sp|Q89AB3|RECB_BUCBP RecBCD enzyme subunit RecB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=recB PE=3 SV=1 191 424 2.0E-07
sp|Q2RL77|ADDA_MOOTA ATP-dependent helicase/nuclease subunit A OS=Moorella thermoacetica (strain ATCC 39073) GN=addA PE=3 SV=1 174 299 2.0E-07
sp|B7IL84|ADDA_BACC2 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain G9842) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|B7JDU4|ADDA_BACC0 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain AH820) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|A0RAX7|ADDA_BACAH ATP-dependent helicase/nuclease subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|B7HGP9|ADDA_BACC4 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain B4264) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|Q81GP9|ADDA_BACCR ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|Q63EM2|ADDA_BACCZ ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ZK / E33L) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|Q73C23|ADDA_BACC1 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|Q73C23|ADDA_BACC1 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=addA PE=3 SV=1 348 647 3.0E-07
sp|B9ITE9|ADDA_BACCQ ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain Q1) GN=addA PE=3 SV=1 348 647 3.0E-07
sp|B9ITE9|ADDA_BACCQ ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain Q1) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|Q6HM43|ADDA_BACHK ATP-dependent helicase/nuclease subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|Q6HM43|ADDA_BACHK ATP-dependent helicase/nuclease subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=addA PE=3 SV=1 348 647 3.0E-07
sp|B7HZR5|ADDA_BACC7 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain AH187) GN=addA PE=3 SV=1 348 647 3.0E-07
sp|B7HZR5|ADDA_BACC7 ATP-dependent helicase/nuclease subunit A OS=Bacillus cereus (strain AH187) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|A4VUD2|ADDA_STRSY ATP-dependent helicase/nuclease subunit A OS=Streptococcus suis (strain 05ZYH33) GN=addA PE=3 SV=1 19 119 3.0E-07
sp|A4W0M7|ADDA_STRS2 ATP-dependent helicase/nuclease subunit A OS=Streptococcus suis (strain 98HAH33) GN=addA PE=3 SV=1 19 119 3.0E-07
sp|Q0AXU8|ADDA_SYNWW ATP-dependent helicase/nuclease subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=addA PE=3 SV=1 19 136 3.0E-07
sp|B0K213|ADDA_THEPX ATP-dependent helicase/nuclease subunit A OS=Thermoanaerobacter sp. (strain X514) GN=addA PE=3 SV=1 17 128 3.0E-07
sp|B0KDB7|ADDA_THEP3 ATP-dependent helicase/nuclease subunit A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=addA PE=3 SV=1 17 128 3.0E-07
sp|A8AY33|ADDA_STRGC ATP-dependent helicase/nuclease subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=addA PE=3 SV=1 19 136 4.0E-07
sp|P08394|RECB_ECOLI RecBCD enzyme subunit RecB OS=Escherichia coli (strain K12) GN=recB PE=1 SV=1 187 429 4.0E-07
sp|Q81TW1|ADDA_BACAN ATP-dependent helicase/nuclease subunit A OS=Bacillus anthracis GN=addA PE=3 SV=1 19 136 7.0E-07
sp|Q71X99|ADDA_LISMF ATP-dependent helicase/nuclease subunit A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=addA PE=3 SV=1 6 136 8.0E-07
sp|A9VJ02|ADDA_BACWK ATP-dependent helicase/nuclease subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=addA PE=3 SV=1 348 641 9.0E-07
sp|A8FBR1|ADDA_BACP2 ATP-dependent helicase/nuclease subunit A OS=Bacillus pumilus (strain SAFR-032) GN=addA PE=3 SV=1 14 136 1.0E-06
sp|Q38X69|ADDA_LACSS ATP-dependent helicase/nuclease subunit A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=addA PE=3 SV=1 18 129 1.0E-06
sp|Q18AN9|ADDA_PEPD6 ATP-dependent helicase/nuclease subunit A OS=Peptoclostridium difficile (strain 630) GN=addA PE=3 SV=1 19 121 1.0E-06
sp|A5D1P3|ADDA_PELTS ATP-dependent helicase/nuclease subunit A OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=addA PE=3 SV=1 1 128 1.0E-06
sp|B1YKM8|ADDA_EXIS2 ATP-dependent helicase/nuclease subunit A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=addA PE=3 SV=1 181 428 1.0E-06
sp|P9WMQ3|RECB_MYCTU RecBCD enzyme subunit RecB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=recB PE=1 SV=1 176 300 1.0E-06
sp|P9WMQ2|RECB_MYCTO RecBCD enzyme subunit RecB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=recB PE=3 SV=1 176 300 1.0E-06
sp|A7Z368|ADDA_BACMF ATP-dependent helicase/nuclease subunit A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=addA PE=3 SV=1 19 136 3.0E-06
sp|Q8RCZ0|ADDA_CALS4 ATP-dependent helicase/nuclease subunit A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=addA PE=3 SV=1 17 128 3.0E-06
sp|B2A610|ADDA_NATTJ ATP-dependent helicase/nuclease subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=addA PE=3 SV=1 174 292 4.0E-06
sp|A4IKW7|ADDA_GEOTN ATP-dependent helicase/nuclease subunit A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=addA PE=3 SV=1 136 293 5.0E-06
sp|B1I493|ADDA_DESAP ATP-dependent helicase/nuclease subunit A OS=Desulforudis audaxviator (strain MP104C) GN=addA PE=3 SV=1 19 136 8.0E-06
sp|A0AL18|ADDA_LISW6 ATP-dependent helicase/nuclease subunit A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=addA PE=3 SV=1 19 128 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|148
MASTDPHVASTLQTLNEAQRRAVTSDASTVAILAGPGSGKTHTLTSRVVWLVRHAGYRPSDLIVATFTVKAATEM
RKRIAKILGEASEKNIVLGTFHSIARRYLATYGTRIGIDPRFDIADSDDSRLIIERICKQLKLQIEPLHARAWIS
KRKSQGTKSAARQNRKQIPENPALIKCLDEYQAALARSNLLDYDDLLVRCVELLETHGSCVSNVQAVLVDEFQDT
NGIQYELMKLFAQAQQRITIVGDPDQSIYGWRSAEIRNLYRLLREYPGTHEVSLEENYRSSQRILDTSLDVIQQD
KKRYKKALLPVHVKGERPVLRTLKSAAAEGEWIVTELRRAVMMLPGILQYQDIAILLRSASLSRHIESALGKAGV
PYCMIGGSKFYDRREIKILLDYLRVIYQPDNNEALARILNVPCRGIGEITVKSLLEEARQRQISLWALLCRHCRG
HGKMTTNIRPKQEQKLTTELIRIITTLRRKWERMSESSPPPLVDLIEDVVKQLKFQEYLEGKFDKDHEGRWANVL
ELVKLAGDFVRDADTLDADTLPSVQGVEQAKNDDMLGRFLVNVALASSAQRDDGCQDKTAMVTMSTIHAAKGLEW
PIVFVPSVYTGSIPHSRSQDLDEERRLLYVAMTRAQALLYLSFPLHDQQGSGNRLDLSPFVSPFASRFSLKGPSF
DKSVTDGVAKILGKPAPTQKAIYDQLPAMFSPEDDGFPIEPFETSLEGGEWDANSRHYYRAPKRQRLLHSKAHSA
KEYDGDEENQSGRWKPEYSTTMDKASEFTMATMPGFVTAGMHKTTLEAAAAKQSSRGATCRRLGGQSSLLNFVRA
EPKRQNAKAPPSSAVNSSLVRDSAATARHAQAAATSLLPREPTTDEPKGCIDAQFAGHKLATGRLLARPRSTSHG
KDDSSWERACCFSSSPPRESWPPKQQAEKLTQQALQPTTSFHATTFVTATRTSGMRRPKRLGPAPSINRLNKPFK
PLTMQRPGR*
Coding >OphauG2|148
ATGGCCTCGACGGATCCGCATGTCGCGTCCACCCTCCAGACGCTCAATGAGGCCCAACGCCGAGCAGTCACGTCC
GATGCATCCACCGTCGCCATCCTTGCCGGCCCAGGAAGCGGCAAGACGCATACCTTGACCTCTCGCGTTGTATGG
CTGGTCCGCCATGCTGGCTACCGGCCGTCAGACTTGATTGTCGCCACCTTTACTGTCAAGGCCGCCACTGAGATG
AGAAAGCGCATTGCAAAGATATTGGGCGAGGCTTCGGAAAAGAATATTGTTCTCGGCACATTCCACTCGATAGCT
CGTCGCTATCTGGCTACCTACGGCACCCGAATCGGCATTGACCCCAGATTCGATATTGCAGACTCGGACGACTCG
CGCCTCATTATCGAGAGGATATGCAAGCAGCTCAAGCTACAAATCGAACCACTGCATGCCCGCGCATGGATCAGC
AAGAGAAAGTCGCAGGGCACAAAGTCTGCTGCTCGTCAGAACAGAAAGCAAATACCGGAAAACCCAGCGCTCATC
AAGTGCCTTGACGAATATCAAGCAGCCCTTGCCCGGTCAAACCTCCTCGATTACGATGATTTGCTCGTGCGCTGT
GTCGAGCTACTGGAAACCCACGGCTCCTGTGTCTCCAATGTCCAGGCAGTGCTTGTCGATGAGTTTCAAGACACG
AATGGCATTCAGTACGAGCTCATGAAACTCTTTGCCCAGGCACAACAGCGCATCACCATTGTTGGCGACCCGGAT
CAGAGTATCTACGGCTGGCGCTCTGCCGAAATCCGCAATCTCTACCGTCTTCTCCGCGAATATCCCGGCACCCAT
GAAGTGTCCCTCGAGGAGAATTACCGATCCTCCCAGCGCATACTTGACACGTCCCTTGATGTCATTCAGCAGGAC
AAAAAGCGCTACAAGAAAGCTCTGCTCCCAGTTCATGTCAAGGGCGAGAGACCGGTTCTCAGGACACTCAAGAGC
GCAGCCGCCGAGGGTGAATGGATCGTGACTGAACTCAGGCGGGCTGTCATGATGCTCCCAGGCATTCTACAATAT
CAAGACATCGCTATTCTTCTTCGCTCGGCCTCTTTGTCAAGACACATTGAGTCGGCGCTGGGCAAAGCAGGAGTG
CCCTATTGCATGATTGGAGGGAGCAAATTCTACGACCGCAGAGAAATCAAGATCTTGCTTGACTATCTGCGCGTC
ATCTACCAGCCCGACAATAATGAGGCATTGGCTCGGATACTCAATGTCCCATGTCGCGGGATTGGTGAAATTACC
GTCAAATCACTTTTGGAAGAGGCCAGGCAACGCCAAATTAGTCTTTGGGCGCTGTTGTGCCGTCACTGCCGCGGA
CATGGCAAAATGACGACCAACATCCGCCCAAAACAGGAGCAAAAGCTCACCACGGAGCTTATACGCATCATTACT
ACCCTGAGGCGAAAATGGGAGCGGATGAGTGAGAGCAGCCCGCCCCCCTTGGTCGACCTAATAGAAGACGTTGTC
AAGCAGCTCAAGTTTCAAGAGTATCTCGAGGGCAAATTCGACAAAGACCACGAGGGCAGATGGGCCAACGTTCTG
GAGCTTGTCAAATTGGCAGGCGACTTTGTGCGCGATGCCGACACATTGGACGCCGATACTCTTCCATCAGTACAG
GGGGTTGAGCAAGCTAAAAATGACGACATGCTGGGCCGATTCTTGGTCAATGTGGCTCTAGCATCGAGCGCACAG
AGAGACGATGGGTGCCAGGACAAGACGGCCATGGTTACCATGTCAACTATTCATGCAGCAAAGGGCCTTGAATGG
CCCATCGTCTTTGTTCCATCGGTATATACTGGATCTATACCCCACTCACGCTCTCAGGACCTAGACGAGGAAAGA
CGTCTGCTATATGTTGCCATGACTCGAGCTCAAGCACTGCTATACCTCAGCTTTCCTCTCCACGACCAGCAGGGA
TCGGGTAACCGGCTGGATCTTTCTCCCTTTGTGTCGCCGTTTGCCTCGAGATTTTCGCTCAAGGGGCCCTCGTTT
GACAAATCTGTGACTGATGGAGTGGCCAAGATTCTCGGGAAGCCAGCGCCGACGCAAAAGGCCATCTACGACCAG
CTGCCAGCCATGTTCTCACCCGAAGACGATGGATTTCCCATTGAACCATTTGAAACGAGCTTGGAGGGTGGCGAA
TGGGACGCCAACAGTCGTCACTACTACAGGGCCCCGAAGCGACAGCGTCTCTTGCACTCGAAAGCGCATTCTGCC
AAGGAGTATGATGGCGATGAAGAGAATCAAAGTGGGCGGTGGAAACCAGAATACAGCACGACAATGGACAAGGCG
TCCGAATTTACCATGGCAACAATGCCCGGTTTTGTCACGGCCGGTATGCATAAGACGACTTTGGAGGCCGCAGCA
GCCAAGCAAAGCTCAAGGGGCGCAACATGTCGTCGTCTGGGCGGCCAGAGTAGTCTGCTAAACTTTGTCAGGGCC
GAGCCCAAGCGGCAGAATGCAAAAGCACCGCCTTCTTCAGCCGTAAACTCCTCCCTCGTGCGAGACAGTGCTGCC
ACAGCGCGTCATGCCCAGGCTGCTGCAACATCATTGCTGCCGCGGGAACCTACCACTGATGAGCCCAAGGGGTGC
ATTGATGCTCAATTTGCTGGGCACAAGTTGGCGACAGGCAGATTACTAGCACGTCCACGCAGCACCAGCCATGGC
AAAGACGACAGCTCTTGGGAACGAGCTTGCTGCTTCTCGAGCTCACCGCCGCGAGAAAGTTGGCCCCCCAAGCAA
CAGGCTGAAAAGCTCACACAGCAGGCGCTCCAACCCACCACAAGCTTCCATGCAACCACGTTTGTCACGGCAACA
CGGACGAGTGGCATGAGGAGGCCCAAGAGGCTAGGTCCAGCGCCTTCGATAAACCGACTGAATAAGCCGTTTAAG
CCGCTGACGATGCAGCGTCCTGGACGATGA
Transcript >OphauG2|148
ATGGCCTCGACGGATCCGCATGTCGCGTCCACCCTCCAGACGCTCAATGAGGCCCAACGCCGAGCAGTCACGTCC
GATGCATCCACCGTCGCCATCCTTGCCGGCCCAGGAAGCGGCAAGACGCATACCTTGACCTCTCGCGTTGTATGG
CTGGTCCGCCATGCTGGCTACCGGCCGTCAGACTTGATTGTCGCCACCTTTACTGTCAAGGCCGCCACTGAGATG
AGAAAGCGCATTGCAAAGATATTGGGCGAGGCTTCGGAAAAGAATATTGTTCTCGGCACATTCCACTCGATAGCT
CGTCGCTATCTGGCTACCTACGGCACCCGAATCGGCATTGACCCCAGATTCGATATTGCAGACTCGGACGACTCG
CGCCTCATTATCGAGAGGATATGCAAGCAGCTCAAGCTACAAATCGAACCACTGCATGCCCGCGCATGGATCAGC
AAGAGAAAGTCGCAGGGCACAAAGTCTGCTGCTCGTCAGAACAGAAAGCAAATACCGGAAAACCCAGCGCTCATC
AAGTGCCTTGACGAATATCAAGCAGCCCTTGCCCGGTCAAACCTCCTCGATTACGATGATTTGCTCGTGCGCTGT
GTCGAGCTACTGGAAACCCACGGCTCCTGTGTCTCCAATGTCCAGGCAGTGCTTGTCGATGAGTTTCAAGACACG
AATGGCATTCAGTACGAGCTCATGAAACTCTTTGCCCAGGCACAACAGCGCATCACCATTGTTGGCGACCCGGAT
CAGAGTATCTACGGCTGGCGCTCTGCCGAAATCCGCAATCTCTACCGTCTTCTCCGCGAATATCCCGGCACCCAT
GAAGTGTCCCTCGAGGAGAATTACCGATCCTCCCAGCGCATACTTGACACGTCCCTTGATGTCATTCAGCAGGAC
AAAAAGCGCTACAAGAAAGCTCTGCTCCCAGTTCATGTCAAGGGCGAGAGACCGGTTCTCAGGACACTCAAGAGC
GCAGCCGCCGAGGGTGAATGGATCGTGACTGAACTCAGGCGGGCTGTCATGATGCTCCCAGGCATTCTACAATAT
CAAGACATCGCTATTCTTCTTCGCTCGGCCTCTTTGTCAAGACACATTGAGTCGGCGCTGGGCAAAGCAGGAGTG
CCCTATTGCATGATTGGAGGGAGCAAATTCTACGACCGCAGAGAAATCAAGATCTTGCTTGACTATCTGCGCGTC
ATCTACCAGCCCGACAATAATGAGGCATTGGCTCGGATACTCAATGTCCCATGTCGCGGGATTGGTGAAATTACC
GTCAAATCACTTTTGGAAGAGGCCAGGCAACGCCAAATTAGTCTTTGGGCGCTGTTGTGCCGTCACTGCCGCGGA
CATGGCAAAATGACGACCAACATCCGCCCAAAACAGGAGCAAAAGCTCACCACGGAGCTTATACGCATCATTACT
ACCCTGAGGCGAAAATGGGAGCGGATGAGTGAGAGCAGCCCGCCCCCCTTGGTCGACCTAATAGAAGACGTTGTC
AAGCAGCTCAAGTTTCAAGAGTATCTCGAGGGCAAATTCGACAAAGACCACGAGGGCAGATGGGCCAACGTTCTG
GAGCTTGTCAAATTGGCAGGCGACTTTGTGCGCGATGCCGACACATTGGACGCCGATACTCTTCCATCAGTACAG
GGGGTTGAGCAAGCTAAAAATGACGACATGCTGGGCCGATTCTTGGTCAATGTGGCTCTAGCATCGAGCGCACAG
AGAGACGATGGGTGCCAGGACAAGACGGCCATGGTTACCATGTCAACTATTCATGCAGCAAAGGGCCTTGAATGG
CCCATCGTCTTTGTTCCATCGGTATATACTGGATCTATACCCCACTCACGCTCTCAGGACCTAGACGAGGAAAGA
CGTCTGCTATATGTTGCCATGACTCGAGCTCAAGCACTGCTATACCTCAGCTTTCCTCTCCACGACCAGCAGGGA
TCGGGTAACCGGCTGGATCTTTCTCCCTTTGTGTCGCCGTTTGCCTCGAGATTTTCGCTCAAGGGGCCCTCGTTT
GACAAATCTGTGACTGATGGAGTGGCCAAGATTCTCGGGAAGCCAGCGCCGACGCAAAAGGCCATCTACGACCAG
CTGCCAGCCATGTTCTCACCCGAAGACGATGGATTTCCCATTGAACCATTTGAAACGAGCTTGGAGGGTGGCGAA
TGGGACGCCAACAGTCGTCACTACTACAGGGCCCCGAAGCGACAGCGTCTCTTGCACTCGAAAGCGCATTCTGCC
AAGGAGTATGATGGCGATGAAGAGAATCAAAGTGGGCGGTGGAAACCAGAATACAGCACGACAATGGACAAGGCG
TCCGAATTTACCATGGCAACAATGCCCGGTTTTGTCACGGCCGGTATGCATAAGACGACTTTGGAGGCCGCAGCA
GCCAAGCAAAGCTCAAGGGGCGCAACATGTCGTCGTCTGGGCGGCCAGAGTAGTCTGCTAAACTTTGTCAGGGCC
GAGCCCAAGCGGCAGAATGCAAAAGCACCGCCTTCTTCAGCCGTAAACTCCTCCCTCGTGCGAGACAGTGCTGCC
ACAGCGCGTCATGCCCAGGCTGCTGCAACATCATTGCTGCCGCGGGAACCTACCACTGATGAGCCCAAGGGGTGC
ATTGATGCTCAATTTGCTGGGCACAAGTTGGCGACAGGCAGATTACTAGCACGTCCACGCAGCACCAGCCATGGC
AAAGACGACAGCTCTTGGGAACGAGCTTGCTGCTTCTCGAGCTCACCGCCGCGAGAAAGTTGGCCCCCCAAGCAA
CAGGCTGAAAAGCTCACACAGCAGGCGCTCCAACCCACCACAAGCTTCCATGCAACCACGTTTGTCACGGCAACA
CGGACGAGTGGCATGAGGAGGCCCAAGAGGCTAGGTCCAGCGCCTTCGATAAACCGACTGAATAAGCCGTTTAAG
CCGCTGACGATGCAGCGTCCTGGACGATGA
Gene >OphauG2|148
ATGGCCTCGACGGATCCGCATGTCGCGTCCACCCTCCAGACGCTCAATGAGGCCCAACGCCGAGCAGTCACGTCC
GATGCATCCACCGTCGCCATCCTTGCCGGCCCAGGAAGCGGCAAGACGCATACCTTGACCTCTCGCGTTGTATGG
CTGGTCCGCCATGCTGGCTACCGGCCGTCAGACTTGATTGTCGCCACCTTTACTGTCAAGGCCGCCACTGAGATG
AGAAAGCGCATTGCAAAGATATTGGGCGAGGCTTCGGAAAAGAATATTGTTCTCGGCACATTCCACTCGATAGCT
CGTCGCTATCTGGCTACCTACGGCACCCGAATCGGCATTGACCCCAGATTCGATATTGCAGACTCGGACGACTCG
CGCCTCATTATCGAGAGGATATGCAAGCAGCTCAAGCTACAAATCGAACCACTGCATGCCCGCGCATGGATCAGC
AAGAGAAAGTCGCAGGGCACAAAGTCTGCTGCTCGTCAGAACAGAAAGCAAATACCGGAAAACCCAGCGCTCATC
AAGTGCCTTGACGAATATCAAGCAGCCCTTGCCCGGTCAAACCTCCTCGATTACGATGATTTGCTCGTGCGCTGT
GTCGAGCTACTGGAAACCCACGGCTCCTGTGTCTCCAATGTCCAGGCAGTGCTTGTCGATGAGTTTCAAGACACG
AATGGCATTCAGTACGAGCTCATGAAACTCTTTGCCCAGGCACAACAGCGCATCACCATTGTTGGCGACCCGGAT
CAGAGTATCTACGGCTGGCGCTCTGCCGAAATCCGCAATCTCTACCGTCTTCTCCGCGAATATCCCGGCACCCAT
GAAGTGTCCCTCGAGGAGAATTACCGATCCTCCCAGCGCATACTTGACACGTCCCTTGATGTCATTCAGCAGGAC
AAAAAGCGCTACAAGAAAGCTCTGCTCCCAGTTCATGTCAAGGGCGAGAGACCGGTTCTCAGGACACTCAAGAGC
GCAGCCGCCGAGGGTGAATGGATCGTGACTGAACTCAGGCGGGCTGTCATGATGCTCCCAGGCATTCTACAATAT
CAAGACATCGCTATTCTTCTTCGCTCGGCCTCTTTGTCAAGACACATTGAGTCGGCGCTGGGCAAAGCAGGAGTG
CCCTATTGCATGATTGGAGGGAGCAAATTCTACGACCGCAGAGAAATCAAGATCTTGCTTGACTATCTGCGCGTC
ATCTACCAGCCCGACAATAATGAGGCATTGGCTCGGATACTCAATGTCCCATGTCGCGGGATTGGTGAAATTACC
GTCAAATCACTTTTGGAAGAGGCCAGGCAACGCCAAATTAGTCTTTGGGCGCTGTTGTGCCGTCACTGCCGCGGA
CATGGCAAAATGACGACCAACATCCGCCCAAAACAGGAGCAAAAGCTCACCACGGAGCTTATACGCATCATTACT
ACCCTGAGGCGAAAATGGGAGCGGATGAGTGAGAGCAGCCCGCCCCCCTTGGTCGACCTAATAGAAGACGTTGTC
AAGCAGCTCAAGTTTCAAGAGTATCTCGAGGGCAAATTCGACAAAGACCACGAGGGCAGATGGGCCAACGTTCTG
GAGCTTGTCAAATTGGCAGGCGACTTTGTGCGCGATGCCGACACATTGGACGCCGATACTCTTCCATCAGTACAG
GGGGTTGAGCAAGCTAAAAATGACGACATGCTGGGCCGATTCTTGGTCAATGTGGCTCTAGCATCGAGCGCACAG
AGAGACGATGGGTGCCAGGACAAGACGGCCATGGTTACCATGTCAACTATTCATGCAGCAAAGGGCCTTGAATGG
CCCATCGTCTTTGTTCCATCGGTATATACTGGATCTATACCCCACTCACGCTCTCAGGACCTAGACGAGGAAAGA
CGTCTGCTATATGTTGCCATGACTCGAGCTCAAGCACTGCTATACCTCAGCTTTCCTCTCCACGACCAGCAGGGA
TCGGGTAACCGGCTGGATCTTTCTCCCTTTGTGTCGCCGTTTGCCTCGAGATTTTCGCTCAAGGGGCCCTCGTTT
GACAAATCTGTGACTGATGGAGTGGCCAAGATTCTCGGGAAGCCAGCGCCGACGCAAAAGGCCATCTACGACCAG
CTGCCAGCCATGTTCTCACCCGAAGACGATGGATTTCCCATTGAACCATTTGAAACGAGCTTGGAGGGTGGCGAA
TGGGACGCCAACAGTCGTCACTACTACAGGGCCCCGAAGCGACAGCGTCTCTTGCACTCGAAAGCGCATTCTGCC
AAGGAGTATGATGGCGATGAAGAGAATCAAAGTGGGCGGTGGAAACCAGAATACAGCACGACAATGGACAAGGCG
TCCGAATTTACCATGGCAACAATGCCCGGTTTTGTCACGGCCGGTATGCATAAGACGACTTTGGAGGCCGCAGCA
GCCAAGCAAAGCTCAAGGGGCGCAACATGTCGTCGTCTGGGCGGCCAGAGTAGTCTGCTAAACTTTGTCAGGGCC
GAGCCCAAGCGGCAGAATGCAAAAGCACCGCCTTCTTCAGCCGTAAACTCCTCCCTCGTGCGAGACAGTGCTGCC
ACAGCGCGTCATGCCCAGGCTGCTGCAACATCATTGCTGCCGCGGGAACCTACCACTGATGAGCCCAAGGGGTGC
ATTGATGCTCAATTTGCTGGGCACAAGTTGGCGACAGGCAGATTACTAGCACGTCCACGCAGCACCAGCCATGGC
AAAGACGACAGCTCTTGGGAACGAGCTTGCTGCTTCTCGAGCTCACCGCCGCGAGAAAGTTGGCCCCCCAAGCAA
CAGGCTGAAAAGCTCACACAGCAGGCGCTCCAACCCACCACAAGCTTCCATGCAACCACGTTTGTCACGGCAACA
CGGACGAGTGGCATGAGGAGGCCCAAGAGGCTAGGTCCAGCGCCTTCGATAAACCGACTGAATAAGCCGTTTAAG
CCGCTGACGATGCAGCGTCCTGGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail