Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1467
Gene name
LocationContig_1440:2967..3810
Strand-
Gene length (bp)843
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08493 AflR Aflatoxin regulatory protein 1.3E-18 91 185

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0003677 DNA binding Yes
GO:0045122 aflatoxin biosynthetic process Yes
GO:0044281 small molecule metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0008150 biological_process No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0018130 heterocycle biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0043226 organelle No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:1901378 organic heteropentacyclic compound biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0043386 mycotoxin biosynthetic process No
GO:0006083 acetate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044550 secondary metabolite biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0043385 mycotoxin metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0019748 secondary metabolic process No
GO:1901376 organic heteropentacyclic compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009403 toxin biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0009404 toxin metabolic process No
GO:0046222 aflatoxin metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:1901576 organic substance biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7990
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1467 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|592

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1467
MEACDYGSLMPLPANSPDDLLDAESSAASLSDLLMSPDLDGFATDSKTAISAQWLDDLLSPTSHALSDTEGAPLS
SSTASPVSFSACCNPRGCCSAVATRLLSGLHASSPSCLLTLGRPPPPQLSRAVDAVLASCQEALGAMRGLLACPC
YASPSLQLLVAVIVAETLGWYRRIIDAYSCQGQAQAAVVRRSLFVGSHCLDHDLEAAVIGQVLLRRLQELETLIG
DAAWSGQADSRSNHMLGEMHSRMHVFLETQLSAVRRALFNWDHDTPSAGPSHGYR*
Coding >OphauG2|1467
ATGGAAGCGTGTGACTATGGCTCTTTGATGCCGCTGCCAGCCAACTCGCCCGACGACTTGCTGGATGCCGAGAGC
TCTGCCGCCTCGCTCAGCGACCTGCTCATGTCGCCAGATCTCGATGGCTTTGCTACAGACTCCAAGACGGCCATC
TCCGCACAGTGGCTCGACGACTTGCTCTCCCCCACAAGCCACGCTCTCTCCGACACAGAGGGCGCGCCGTTGAGC
TCCAGCACCGCGTCGCCCGTCTCCTTTTCCGCCTGCTGCAATCCTCGCGGCTGCTGCTCCGCCGTGGCCACCCGG
CTGCTCTCTGGGCTTCACGCCAGCTCTCCCAGCTGCCTGCTCACCCTCGGCCGCCCTCCGCCGCCTCAGCTGTCC
CGCGCCGTCGATGCCGTCCTCGCCTCGTGCCAAGAAGCGCTGGGGGCCATGCGCGGCTTACTGGCCTGCCCCTGC
TATGCCAGTCCGTCGCTGCAGCTGCTGGTAGCTGTCATTGTTGCCGAGACTCTCGGCTGGTACCGGCGCATCATT
GACGCCTACAGCTGCCAGGGCCAGGCCCAAGCAGCCGTGGTGAGACGCTCCCTGTTTGTCGGGAGCCATTGCCTG
GACCATGACTTGGAGGCAGCTGTCATTGGCCAGGTTTTGCTGCGTCGCTTGCAGGAACTGGAGACGCTCATCGGA
GACGCTGCCTGGAGCGGCCAGGCCGATTCTAGAAGCAATCACATGCTGGGAGAGATGCATTCCAGAATGCATGTC
TTTCTAGAAACTCAGCTAAGCGCGGTGAGGCGCGCGCTATTCAACTGGGACCATGACACGCCGTCAGCAGGGCCA
TCACACGGCTATAGATGA
Transcript >OphauG2|1467
ATGGAAGCGTGTGACTATGGCTCTTTGATGCCGCTGCCAGCCAACTCGCCCGACGACTTGCTGGATGCCGAGAGC
TCTGCCGCCTCGCTCAGCGACCTGCTCATGTCGCCAGATCTCGATGGCTTTGCTACAGACTCCAAGACGGCCATC
TCCGCACAGTGGCTCGACGACTTGCTCTCCCCCACAAGCCACGCTCTCTCCGACACAGAGGGCGCGCCGTTGAGC
TCCAGCACCGCGTCGCCCGTCTCCTTTTCCGCCTGCTGCAATCCTCGCGGCTGCTGCTCCGCCGTGGCCACCCGG
CTGCTCTCTGGGCTTCACGCCAGCTCTCCCAGCTGCCTGCTCACCCTCGGCCGCCCTCCGCCGCCTCAGCTGTCC
CGCGCCGTCGATGCCGTCCTCGCCTCGTGCCAAGAAGCGCTGGGGGCCATGCGCGGCTTACTGGCCTGCCCCTGC
TATGCCAGTCCGTCGCTGCAGCTGCTGGTAGCTGTCATTGTTGCCGAGACTCTCGGCTGGTACCGGCGCATCATT
GACGCCTACAGCTGCCAGGGCCAGGCCCAAGCAGCCGTGGTGAGACGCTCCCTGTTTGTCGGGAGCCATTGCCTG
GACCATGACTTGGAGGCAGCTGTCATTGGCCAGGTTTTGCTGCGTCGCTTGCAGGAACTGGAGACGCTCATCGGA
GACGCTGCCTGGAGCGGCCAGGCCGATTCTAGAAGCAATCACATGCTGGGAGAGATGCATTCCAGAATGCATGTC
TTTCTAGAAACTCAGCTAAGCGCGGTGAGGCGCGCGCTATTCAACTGGGACCATGACACGCCGTCAGCAGGGCCA
TCACACGGCTATAGATGA
Gene >OphauG2|1467
ATGGAAGCGTGTGACTATGGCTCTTTGATGCCGCTGCCAGCCAACTCGCCCGACGACTTGCTGGATGCCGAGAGC
TCTGCCGCCTCGCTCAGCGACCTGCTCATGTCGCCAGATCTCGATGGCTTTGCTACAGACTCCAAGACGGCCATC
TCCGCACAGTGGCTCGACGACTTGCTCTCCCCCACAAGCCACGCTCTCTCCGACACAGAGGGCGCGCCGTTGAGC
TCCAGCACCGCGTCGCCCGTCTCCTTTTCCGCCTGCTGCAATCCTCGCGGCTGCTGCTCCGCCGTGGCCACCCGG
CTGCTCTCTGGGCTTCACGCCAGCTCTCCCAGCTGCCTGCTCACCCTCGGCCGCCCTCCGCCGCCTCAGCTGTCC
CGCGCCGTCGATGCCGTCCTCGCCTCGTGCCAAGAAGCGCTGGGGGCCATGCGCGGCTTACTGGCCTGCCCCTGC
TATGCCAGTCCGTCGCTGCAGCTGCTGGTAGCTGTCATTGTTGCCGAGACTCTCGGCTGGTACCGGCGCATCATT
GACGCCTACAGCTGCCAGGGCCAGGCCCAAGCAGCCGTGGTGAGACGCTCCCTGTTTGTCGGGAGCCATTGCCTG
GACCATGACTTGGAGGCAGCTGTCATTGGCCAGGTTTTGCTGCGTCGCTTGCAGGAACTGGAGACGCTCATCGGA
GACGCTGCCTGGAGCGGCCAGGCCGATTCTAGAAGCAATCACATGCTGGGAGAGATGCATTCCAGAATGCATGTC
TTTCTAGAAACTCAGCTAAGCGCGGTGAGGCGCGCGCTATTCAACTGGGACCATGACACGCCGTCAGCAGGGCCA
TCACACGGCTATAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail