Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1465
Gene name
LocationContig_144:28800..29671
Strand+
Gene length (bp)871
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03997 VPS28 VPS28 protein 1.3E-65 44 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02767|VPS28_YEAST Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS28 PE=1 SV=1 28 240 8.0E-44
sp|O13872|VPS28_SCHPO Vacuolar protein sorting-associated protein 28 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps28 PE=3 SV=1 39 237 1.0E-39
sp|Q9S9T7|VP282_ARATH Vacuolar protein sorting-associated protein 28 homolog 2 OS=Arabidopsis thaliana GN=VPS28-2 PE=1 SV=2 28 244 1.0E-32
sp|Q9V359|VPS28_DROME Vacuolar protein sorting-associated protein 28 homolog OS=Drosophila melanogaster GN=Vps28 PE=1 SV=1 25 244 4.0E-31
sp|Q9UK41|VPS28_HUMAN Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens GN=VPS28 PE=1 SV=1 25 244 1.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02767|VPS28_YEAST Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS28 PE=1 SV=1 28 240 8.0E-44
sp|O13872|VPS28_SCHPO Vacuolar protein sorting-associated protein 28 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps28 PE=3 SV=1 39 237 1.0E-39
sp|Q9S9T7|VP282_ARATH Vacuolar protein sorting-associated protein 28 homolog 2 OS=Arabidopsis thaliana GN=VPS28-2 PE=1 SV=2 28 244 1.0E-32
sp|Q9V359|VPS28_DROME Vacuolar protein sorting-associated protein 28 homolog OS=Drosophila melanogaster GN=Vps28 PE=1 SV=1 25 244 4.0E-31
sp|Q9UK41|VPS28_HUMAN Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens GN=VPS28 PE=1 SV=1 25 244 1.0E-29
sp|Q3T178|VPS28_BOVIN Vacuolar protein sorting-associated protein 28 homolog OS=Bos taurus GN=VPS28 PE=2 SV=1 25 244 2.0E-29
sp|B5DEN9|VPS28_RAT Vacuolar protein sorting-associated protein 28 homolog OS=Rattus norvegicus GN=Vps28 PE=2 SV=1 25 244 2.0E-29
sp|Q9D1C8|VPS28_MOUSE Vacuolar protein sorting-associated protein 28 homolog OS=Mus musculus GN=Vps28 PE=1 SV=1 25 244 2.0E-29
sp|Q54NF1|VPS28_DICDI Vacuolar protein sorting-associated protein 28 OS=Dictyostelium discoideum GN=vps28 PE=3 SV=1 27 244 5.0E-29
sp|Q9NA26|VPS28_CAEEL Vacuolar protein sorting-associated protein 28 homolog OS=Caenorhabditis elegans GN=vps-28 PE=1 SV=1 24 245 3.0E-28
sp|A8XWB7|VPS28_CAEBR Vacuolar protein sorting-associated protein 28 homolog OS=Caenorhabditis briggsae GN=vps-28 PE=3 SV=1 24 245 6.0E-28
sp|O65421|VP281_ARATH Vacuolar protein sorting-associated protein 28 homolog 1 OS=Arabidopsis thaliana GN=VPS28-1 PE=1 SV=1 28 244 2.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0032509 endosome transport via multivesicular body sorting pathway Yes
GO:0000813 ESCRT I complex Yes
GO:0016192 vesicle-mediated transport No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0046907 intracellular transport No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0051179 localization No
GO:0098796 membrane protein complex No
GO:0016197 endosomal transport No
GO:0051641 cellular localization No
GO:0071985 multivesicular body sorting pathway No
GO:0036452 ESCRT complex No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1465
MSMQGYAPTPHSYIPDPSLTATINLDQEVQLCDSRSESHVQDSLAELFSIIVTLDELERAFLKDAVPEAEYSEIC
ERSLRQYKALLADETIAREFGSLEDFKTKWELEAPRATERIRIGLPSTTVTASSFAPPGQQSSAQGSGGGGGSGG
ASGVLILEATQEFITFLDAVKLGMLSKDQLHPLLSDVIQSVNRVTDQDFDNRAKIVQWLITLNQMKATEELSEPQ
ARELELDIQQAYQGFRRTLS*
Coding >OphauG2|1465
ATGTCAATGCAAGGCTACGCGCCCACGCCCCATAGTTATATCCCCGACCCGAGCCTCACAGCAACCATCAATCTC
GACCAAGAGGTGCAGCTATGTGACAGCCGCTCCGAAAGCCATGTACAGGACTCCCTGGCCGAGCTTTTCAGCATA
ATTGTCACGCTTGACGAGCTCGAGCGCGCCTTTCTCAAGGATGCCGTGCCCGAGGCAGAATACAGCGAGATATGC
GAGCGCTCGTTGCGCCAATACAAGGCCCTTTTGGCGGACGAGACAATTGCACGCGAGTTTGGCAGCTTGGAAGAC
TTTAAAACCAAATGGGAGCTCGAGGCTCCCCGTGCTACAGAGCGCATACGCATCGGTCTGCCTTCAACCACAGTC
ACGGCCTCATCTTTTGCTCCGCCGGGCCAGCAGTCTTCGGCGCAGGGCTCTGGCGGTGGTGGAGGGAGCGGCGGT
GCAAGCGGTGTTTTGATTCTTGAAGCGACACAAGAATTCATCACCTTTCTCGATGCCGTAAAGCTTGGCATGCTG
TCCAAAGACCAACTACACCCTCTCTTGTCGGATGTTATCCAGTCGGTCAACCGCGTCACTGACCAGGACTTTGAC
AACCGTGCCAAGATTGTCCAATGGCTCATTACTCTTAACCAGATGAAGGCTACGGAGGAGCTGAGCGAGCCGCAA
GCTCGCGAGCTGGAACTGGACATTCAGCAGGCATACCAGGGATTTAGAAGGACTCTGTCGTGA
Transcript >OphauG2|1465
ATGTCAATGCAAGGCTACGCGCCCACGCCCCATAGTTATATCCCCGACCCGAGCCTCACAGCAACCATCAATCTC
GACCAAGAGGTGCAGCTATGTGACAGCCGCTCCGAAAGCCATGTACAGGACTCCCTGGCCGAGCTTTTCAGCATA
ATTGTCACGCTTGACGAGCTCGAGCGCGCCTTTCTCAAGGATGCCGTGCCCGAGGCAGAATACAGCGAGATATGC
GAGCGCTCGTTGCGCCAATACAAGGCCCTTTTGGCGGACGAGACAATTGCACGCGAGTTTGGCAGCTTGGAAGAC
TTTAAAACCAAATGGGAGCTCGAGGCTCCCCGTGCTACAGAGCGCATACGCATCGGTCTGCCTTCAACCACAGTC
ACGGCCTCATCTTTTGCTCCGCCGGGCCAGCAGTCTTCGGCGCAGGGCTCTGGCGGTGGTGGAGGGAGCGGCGGT
GCAAGCGGTGTTTTGATTCTTGAAGCGACACAAGAATTCATCACCTTTCTCGATGCCGTAAAGCTTGGCATGCTG
TCCAAAGACCAACTACACCCTCTCTTGTCGGATGTTATCCAGTCGGTCAACCGCGTCACTGACCAGGACTTTGAC
AACCGTGCCAAGATTGTCCAATGGCTCATTACTCTTAACCAGATGAAGGCTACGGAGGAGCTGAGCGAGCCGCAA
GCTCGCGAGCTGGAACTGGACATTCAGCAGGCATACCAGGGATTTAGAAGGACTCTGTCGTGA
Gene >OphauG2|1465
ATGTCAATGCAAGGCTACGCGCCCACGCCCCATAGTTATATCCCCGACCCGAGCCTCACAGCAACCATCAATCTC
GACCAAGTGCGGCCCCTGCGCTTGGCACGCAAGAGAAGCAGCATCGAACTAGACTAACCCAGCTAAATGCAGGAG
GTGCAGCTATGTGACAGCCGCTCCGAAAGCCATGTACAGGACTCCCTGGCCGAGCTTTTCAGCATAATTGTCACG
CTTGACGAGCTCGAGCGCGCCTTTCTCAAGGATGCCGTGCCCGAGGCAGAATACAGCGAGATATGCGAGCGCTCG
TTGCGCCAATACAAGGCCCTTTTGGCGGACGAGACAATTGCACGCGAGTTTGGCAGCTTGGAAGACTTTAAAACC
AAATGGGAGGTACGAGTTAATTCCTTCTTGTCTTTGCCTCCCAGCTGTGTGGCTGACGTGGGCGAGGGTGTTGCA
GCTCGAGGCTCCCCGTGCTACAGAGCGCATACGCATCGGTCTGCCTTCAACCACAGTCACGGCCTCATCTTTTGC
TCCGCCGGGCCAGCAGTCTTCGGCGCAGGGCTCTGGCGGTGGTGGAGGGAGCGGCGGTGCAAGCGGTGTTTTGAT
TCTTGAAGCGACACAAGAATTCATCACCTTTCTCGATGCCGTAAAGCTTGGCATGCTGTCCAAAGACCAACTACA
CCCTCTCTTGTCGGATGTTATCCAGTCGGTCAACCGCGTCACTGACCAGGACTTTGACAACCGTGCCAAGATTGT
CCAATGGCTCATTACTCTTAACCAGATGAAGGCTACGGAGGAGCTGAGCGAGCCGCAAGCTCGCGAGCTGGAACT
GGACATTCAGCAGGCATACCAGGGATTTAGAAGGACTCTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail