Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1464
Gene name
LocationContig_144:26132..28508
Strand-
Gene length (bp)2376
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03715 Noc2 Noc2p family 1.0E-114 408 718

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39744|NOC2_YEAST Nucleolar complex protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC2 PE=1 SV=2 9 767 7.0E-130
sp|Q9P7G0|YKY4_SCHPO Uncharacterized NOC2 family protein C1142.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1142.04 PE=1 SV=1 32 778 4.0E-126
sp|Q9WV70|NOC2L_MOUSE Nucleolar complex protein 2 homolog OS=Mus musculus GN=Noc2l PE=1 SV=2 74 723 3.0E-86
sp|Q3SYU1|NOC2L_BOVIN Nucleolar complex protein 2 homolog OS=Bos taurus GN=NOC2L PE=2 SV=1 74 790 3.0E-80
sp|Q9ZPV5|NOC2L_ARATH Nucleolar complex protein 2 homolog OS=Arabidopsis thaliana GN=At2g18220 PE=3 SV=2 151 733 1.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39744|NOC2_YEAST Nucleolar complex protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC2 PE=1 SV=2 9 767 7.0E-130
sp|Q9P7G0|YKY4_SCHPO Uncharacterized NOC2 family protein C1142.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1142.04 PE=1 SV=1 32 778 4.0E-126
sp|Q9WV70|NOC2L_MOUSE Nucleolar complex protein 2 homolog OS=Mus musculus GN=Noc2l PE=1 SV=2 74 723 3.0E-86
sp|Q3SYU1|NOC2L_BOVIN Nucleolar complex protein 2 homolog OS=Bos taurus GN=NOC2L PE=2 SV=1 74 790 3.0E-80
sp|Q9ZPV5|NOC2L_ARATH Nucleolar complex protein 2 homolog OS=Arabidopsis thaliana GN=At2g18220 PE=3 SV=2 151 733 1.0E-78
sp|Q9Y3T9|NOC2L_HUMAN Nucleolar complex protein 2 homolog OS=Homo sapiens GN=NOC2L PE=1 SV=4 74 723 5.0E-76
sp|Q9VIF0|NOC2L_DROME Nucleolar complex protein 2 homolog OS=Drosophila melanogaster GN=CG9246 PE=1 SV=1 148 776 1.0E-62
sp|Q8LNU5|NOC2L_ORYSJ Nucleolar complex protein 2 homolog OS=Oryza sativa subsp. japonica GN=Os10g0495500 PE=2 SV=1 151 745 6.0E-51
sp|A8WTM7|NOC2L_CAEBR Nucleolar complex protein 2 homolog OS=Caenorhabditis briggsae GN=pro-2 PE=3 SV=1 94 715 7.0E-42
sp|O13874|YE19_SCHPO Uncharacterized NOC2 family protein C1B3.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.09c PE=3 SV=1 405 716 8.0E-40
sp|O17580|NOC2L_CAEEL Nucleolar complex protein 2 homolog OS=Caenorhabditis elegans GN=pro-2 PE=2 SV=3 95 715 5.0E-37
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3317
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1464 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7879
Ophiocordyceps camponoti-floridani Ophcf2|01043
Ophiocordyceps camponoti-rufipedis Ophun1|6075
Ophiocordyceps kimflemingae Ophio5|2737
Ophiocordyceps subramaniannii Hirsu2|6130

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1464
MGSSKKNLKATKKFEKKHLKGVLDKRKATAKIKQRQQVKDKKKAKRARDGEFYKGSREEAQPDSKANGTKGPSKV
SEMSVDEFFQGGFEDLIDTKAAKLGKRKRSGTIAREEDQSDSGSHSQGSNAGEPVISEDDDESGVEEEHGMSKAT
MEALASKDPDFYKFLQDNDPDMLDFDEGADLAEVDELSGGEEAESEQETPKKKRKKTKSQTDQEQEKDAKGVSLD
GNELTRALVASWREAIKTGQSLRATRQAVLAFGCAARLNQDEEDDKAPRWTINSPEVFNDILVLALKEIPAVMNH
HIPIKESAAGNVYVPTEGRKFKTLSTLLKSYTSSILHLLATLSDDKTIKMTLSALTPILPYLLSFKKLIKALSKT
VINYWAQPASSETTRITAFLVVRRLVVIGDKSIRQGVLKATYQGLVQACRVTNPNTAQGINLVKVSAAELWGMDG
AVGYTTAFAFIRQLAMHLRKAIVNNQNESFRTVYNWQFVHSLDFWSVVLAEHCSPLKEAETAGRQSQLKLLVYPL
TQLTLGAMRLIPTAAYFPLRFILIGSLLRLSRATGVYMPLASPLLEALSSAELRKRPKPSTLKPLDVGMTLRAPK
SYLGTRVYQDSIGDAIVDLLGEFLLIWATSIAFPELALPISIQLKRWLKIARSPSRGNRNAKVASQVALLVHKME
ANASFIQERRAKVEFAPRERAQVEAFLKDFDVAKTPLGAFVVAQRQIRAQRAEAFAEARKDDERLRRQDETGQEV
ESGDEHLEQEIGSDDDDAQQDDEGDDDDAQQEDEGDDDDDE*
Coding >OphauG2|1464
ATGGGCTCCTCTAAAAAAAATCTCAAAGCAACTAAAAAATTCGAAAAGAAACACCTCAAGGGTGTTCTCGACAAG
CGCAAGGCCACAGCCAAGATCAAGCAGCGCCAACAAGTCAAGGACAAGAAAAAGGCAAAGCGCGCAAGAGATGGC
GAATTCTACAAGGGATCCAGAGAGGAGGCACAGCCTGACAGCAAGGCCAATGGAACAAAAGGCCCCAGCAAAGTC
AGCGAGATGAGCGTCGACGAATTCTTCCAAGGCGGCTTTGAGGACCTGATTGACACCAAAGCTGCCAAGCTGGGT
AAACGGAAACGTTCAGGGACAATTGCGCGGGAGGAGGATCAAAGCGATTCTGGCAGCCATTCGCAAGGCTCGAAT
GCGGGCGAGCCAGTTATCAGTGAAGATGATGACGAGAGTGGGGTTGAAGAGGAACACGGCATGAGCAAAGCGACG
ATGGAGGCGCTGGCCAGCAAGGATCCCGATTTCTACAAGTTTCTCCAGGACAATGACCCCGACATGCTCGACTTT
GACGAGGGTGCGGATCTTGCCGAAGTGGACGAGCTGAGTGGTGGCGAAGAGGCAGAATCAGAGCAAGAGACGCCC
AAAAAGAAGAGGAAGAAGACCAAGAGTCAGACGGACCAAGAGCAAGAAAAAGATGCCAAAGGGGTCTCATTAGAC
GGTAACGAGCTGACGCGTGCTCTTGTGGCATCGTGGAGAGAGGCAATCAAGACTGGCCAATCGTTGCGCGCCACA
AGACAAGCCGTGCTCGCCTTTGGCTGCGCTGCCCGGCTAAACCAAGACGAGGAAGACGATAAGGCGCCGCGGTGG
ACCATCAACAGCCCAGAAGTCTTCAACGACATCCTGGTGCTGGCACTCAAGGAGATCCCAGCTGTCATGAACCAC
CACATTCCCATCAAGGAGTCTGCGGCTGGCAACGTCTACGTGCCGACCGAGGGTCGCAAATTCAAGACGCTATCA
ACGCTGCTCAAGTCATACACATCGTCGATATTGCATCTCTTGGCCACGCTCTCTGACGACAAGACGATTAAGATG
ACGCTTTCAGCCCTGACGCCCATACTGCCTTATCTGCTCTCCTTCAAAAAGCTCATCAAGGCTCTTTCAAAGACG
GTCATCAACTACTGGGCTCAGCCTGCCAGCTCGGAAACGACGCGCATCACAGCCTTTCTCGTGGTGCGCCGCCTC
GTCGTCATTGGCGACAAGTCAATTCGCCAAGGCGTTCTCAAGGCCACTTACCAGGGCCTCGTCCAAGCCTGCCGC
GTCACAAACCCCAACACGGCTCAGGGCATCAATCTCGTCAAGGTCTCGGCCGCGGAGCTATGGGGCATGGATGGG
GCTGTGGGATACACGACGGCGTTTGCTTTTATCCGCCAGCTGGCCATGCACCTGCGCAAGGCCATTGTCAACAAC
CAAAACGAGTCGTTCCGCACCGTCTACAACTGGCAGTTTGTTCACTCGCTCGACTTCTGGTCTGTTGTGCTTGCT
GAGCACTGCAGCCCGCTCAAGGAAGCCGAGACGGCCGGCCGTCAAAGCCAGCTGAAACTACTTGTATATCCCTTG
ACGCAGCTTACCCTTGGTGCCATGCGCCTTATCCCCACGGCGGCCTACTTTCCCTTGCGCTTCATCCTCATTGGC
TCTCTTCTGCGTCTGTCTCGCGCCACGGGTGTCTACATGCCGCTCGCATCTCCGCTTCTCGAGGCCCTGTCGTCG
GCCGAGCTGCGCAAGCGGCCCAAGCCCTCGACACTCAAGCCACTCGATGTTGGCATGACGCTGCGTGCTCCCAAA
TCATACCTGGGCACGCGTGTCTACCAAGACAGCATCGGCGATGCCATTGTCGATTTGCTGGGCGAGTTCCTCCTC
ATCTGGGCCACATCGATTGCCTTTCCCGAGCTAGCCCTGCCCATCTCCATTCAACTGAAGCGCTGGTTGAAGATT
GCGCGCTCCCCATCGCGCGGCAACCGCAATGCCAAGGTTGCCTCGCAGGTGGCGCTCCTGGTGCACAAGATGGAG
GCCAATGCCAGCTTTATCCAAGAGCGGCGCGCCAAAGTAGAGTTTGCTCCACGCGAGCGCGCTCAGGTTGAAGCC
TTCCTCAAGGACTTTGACGTGGCCAAGACGCCGCTTGGTGCGTTTGTGGTGGCGCAGAGGCAGATTCGTGCGCAG
AGAGCTGAGGCGTTTGCCGAGGCACGCAAAGATGATGAGCGGTTGCGGCGCCAAGACGAGACTGGGCAAGAGGTG
GAAAGTGGCGACGAGCATCTTGAACAGGAGATTGGTAGTGACGACGACGATGCGCAGCAGGACGATGAGGGTGAC
GATGACGATGCGCAGCAGGAGGATGAGGGTGACGATGACGATGACGAATAG
Transcript >OphauG2|1464
ATGGGCTCCTCTAAAAAAAATCTCAAAGCAACTAAAAAATTCGAAAAGAAACACCTCAAGGGTGTTCTCGACAAG
CGCAAGGCCACAGCCAAGATCAAGCAGCGCCAACAAGTCAAGGACAAGAAAAAGGCAAAGCGCGCAAGAGATGGC
GAATTCTACAAGGGATCCAGAGAGGAGGCACAGCCTGACAGCAAGGCCAATGGAACAAAAGGCCCCAGCAAAGTC
AGCGAGATGAGCGTCGACGAATTCTTCCAAGGCGGCTTTGAGGACCTGATTGACACCAAAGCTGCCAAGCTGGGT
AAACGGAAACGTTCAGGGACAATTGCGCGGGAGGAGGATCAAAGCGATTCTGGCAGCCATTCGCAAGGCTCGAAT
GCGGGCGAGCCAGTTATCAGTGAAGATGATGACGAGAGTGGGGTTGAAGAGGAACACGGCATGAGCAAAGCGACG
ATGGAGGCGCTGGCCAGCAAGGATCCCGATTTCTACAAGTTTCTCCAGGACAATGACCCCGACATGCTCGACTTT
GACGAGGGTGCGGATCTTGCCGAAGTGGACGAGCTGAGTGGTGGCGAAGAGGCAGAATCAGAGCAAGAGACGCCC
AAAAAGAAGAGGAAGAAGACCAAGAGTCAGACGGACCAAGAGCAAGAAAAAGATGCCAAAGGGGTCTCATTAGAC
GGTAACGAGCTGACGCGTGCTCTTGTGGCATCGTGGAGAGAGGCAATCAAGACTGGCCAATCGTTGCGCGCCACA
AGACAAGCCGTGCTCGCCTTTGGCTGCGCTGCCCGGCTAAACCAAGACGAGGAAGACGATAAGGCGCCGCGGTGG
ACCATCAACAGCCCAGAAGTCTTCAACGACATCCTGGTGCTGGCACTCAAGGAGATCCCAGCTGTCATGAACCAC
CACATTCCCATCAAGGAGTCTGCGGCTGGCAACGTCTACGTGCCGACCGAGGGTCGCAAATTCAAGACGCTATCA
ACGCTGCTCAAGTCATACACATCGTCGATATTGCATCTCTTGGCCACGCTCTCTGACGACAAGACGATTAAGATG
ACGCTTTCAGCCCTGACGCCCATACTGCCTTATCTGCTCTCCTTCAAAAAGCTCATCAAGGCTCTTTCAAAGACG
GTCATCAACTACTGGGCTCAGCCTGCCAGCTCGGAAACGACGCGCATCACAGCCTTTCTCGTGGTGCGCCGCCTC
GTCGTCATTGGCGACAAGTCAATTCGCCAAGGCGTTCTCAAGGCCACTTACCAGGGCCTCGTCCAAGCCTGCCGC
GTCACAAACCCCAACACGGCTCAGGGCATCAATCTCGTCAAGGTCTCGGCCGCGGAGCTATGGGGCATGGATGGG
GCTGTGGGATACACGACGGCGTTTGCTTTTATCCGCCAGCTGGCCATGCACCTGCGCAAGGCCATTGTCAACAAC
CAAAACGAGTCGTTCCGCACCGTCTACAACTGGCAGTTTGTTCACTCGCTCGACTTCTGGTCTGTTGTGCTTGCT
GAGCACTGCAGCCCGCTCAAGGAAGCCGAGACGGCCGGCCGTCAAAGCCAGCTGAAACTACTTGTATATCCCTTG
ACGCAGCTTACCCTTGGTGCCATGCGCCTTATCCCCACGGCGGCCTACTTTCCCTTGCGCTTCATCCTCATTGGC
TCTCTTCTGCGTCTGTCTCGCGCCACGGGTGTCTACATGCCGCTCGCATCTCCGCTTCTCGAGGCCCTGTCGTCG
GCCGAGCTGCGCAAGCGGCCCAAGCCCTCGACACTCAAGCCACTCGATGTTGGCATGACGCTGCGTGCTCCCAAA
TCATACCTGGGCACGCGTGTCTACCAAGACAGCATCGGCGATGCCATTGTCGATTTGCTGGGCGAGTTCCTCCTC
ATCTGGGCCACATCGATTGCCTTTCCCGAGCTAGCCCTGCCCATCTCCATTCAACTGAAGCGCTGGTTGAAGATT
GCGCGCTCCCCATCGCGCGGCAACCGCAATGCCAAGGTTGCCTCGCAGGTGGCGCTCCTGGTGCACAAGATGGAG
GCCAATGCCAGCTTTATCCAAGAGCGGCGCGCCAAAGTAGAGTTTGCTCCACGCGAGCGCGCTCAGGTTGAAGCC
TTCCTCAAGGACTTTGACGTGGCCAAGACGCCGCTTGGTGCGTTTGTGGTGGCGCAGAGGCAGATTCGTGCGCAG
AGAGCTGAGGCGTTTGCCGAGGCACGCAAAGATGATGAGCGGTTGCGGCGCCAAGACGAGACTGGGCAAGAGGTG
GAAAGTGGCGACGAGCATCTTGAACAGGAGATTGGTAGTGACGACGACGATGCGCAGCAGGACGATGAGGGTGAC
GATGACGATGCGCAGCAGGAGGATGAGGGTGACGATGACGATGACGAATAG
Gene >OphauG2|1464
ATGGGCTCCTCTAAAAAAAATCTCAAAGCAACTAAAAAATTCGAAAAGAAACACCTCAAGGGTGTTCTCGACAAG
CGCAAGGCCACAGCCAAGATCAAGCAGCGCCAACAAGTCAAGGACAAGAAAAAGGCAAAGCGCGCAAGAGATGGC
GAATTCTACAAGGGATCCAGAGAGGAGGCACAGCCTGACAGCAAGGCCAATGGAACAAAAGGCCCCAGCAAAGTC
AGCGAGATGAGCGTCGACGAATTCTTCCAAGGCGGCTTTGAGGACCTGATTGACACCAAAGCTGCCAAGCTGGGT
AAACGGAAACGTTCAGGGACAATTGCGCGGGAGGAGGATCAAAGCGATTCTGGCAGCCATTCGCAAGGCTCGAAT
GCGGGCGAGCCAGTTATCAGTGAAGATGATGACGAGAGTGGGGTTGAAGAGGAACACGGCATGAGCAAAGCGACG
ATGGAGGCGCTGGCCAGCAAGGATCCCGATTTCTACAAGTTTCTCCAGGACAATGACCCCGACATGCTCGACTTT
GACGAGGGTGCGGATCTTGCCGAAGTGGACGAGCTGAGTGGTGGCGAAGAGGCAGAATCAGAGCAAGAGACGCCC
AAAAAGAAGAGGAAGAAGACCAAGAGTCAGACGGACCAAGAGCAAGAAAAAGATGCCAAAGGGGTCTCATTAGAC
GGTAACGAGCTGACGCGTGCTCTTGTGGCATCGTGGAGAGAGGCAATCAAGACTGGCCAATCGTTGCGCGCCACA
AGACAAGCCGTGCTCGCCTTTGGCTGCGCTGCCCGGCTAAACCAAGACGAGGAAGACGATAAGGCGCCGCGGTGG
ACCATCAACAGCCCAGAAGTCTTCAACGACATCCTGGTGCTGGCACTCAAGGAGATCCCAGCTGTCATGAACCAC
CACATTCCCATCAAGGAGTCTGCGGCTGGCAACGTCTACGTGCCGACCGAGGGTCGCAAATTCAAGACGCTATCA
ACGCTGCTCAAGTCATACACATCGTCGATATTGCATCTCTTGGCCACGCTCTCTGACGACAAGACGATTAAGATG
ACGCTTTCAGCCCTGACGCCCATACTGCCTTATCTGCTCTCCTTCAAAAAGCTCATCAAGGCTCTTTCAAAGACG
GTCATCAACTACTGGGCTCAGCCTGCCAGCTCGGAAACGACGCGCATCACAGCCTTTCTCGTGGTGCGCCGCCTC
GTCGTCATTGGCGACAAGTCAATTCGCCAAGGCGTTCTCAAGGCCACTTACCAGGGCCTCGTCCAAGCCTGCCGC
GTCACAAACCCCAACACGGCTCAGGGCATCAATCTCGTCAAGGTCTCGGCCGCGGAGCTATGGGGCATGGATGGG
GCTGTGGGATACACGACGGCGTTTGCTTTTATCCGCCAGCTGGCCATGCACCTGCGCAAGGCCATTGTCAACAAC
CAAAACGAGTCGTTCCGCACCGTCTACAACTGGCAGTTTGTTCACTCGCTCGACTTCTGGTCTGTTGTGCTTGCT
GAGCACTGCAGCCCGCTCAAGGAAGCCGAGACGGCCGGCCGTCAAAGCCAGCTGAAACTACTTGTATATCCCTTG
ACGCAGCTTACCCTTGGTGCCATGCGCCTTATCCCCACGGCGGCCTACTTTCCCTTGCGCTTCATCCTCATTGGC
TCTCTTCTGCGTCTGTCTCGCGCCACGGGTGTCTACATGCCGCTCGCATCTCCGCTTCTCGAGGCCCTGTCGTCG
GCCGAGCTGCGCAAGCGGCCCAAGCCCTCGACACTCAAGCCACTCGATGTTGGCATGACGCTGCGTGCTCCCAAA
TCATACCTGGGCACGCGTGTCTACCAAGACAGCATCGGCGATGCCATTGTCGATTTGCTGGGCGAGTTCCTCCTC
ATCTGGGCCACATCGATTGCCTTTCCCGAGCTAGCCCTGCCCATCTCCATTCAACTGAAGCGCTGGTTGAAGATT
GCGCGCTCCCCATCGCGCGGCAACCGCAATGCCAAGGTTGCCTCGCAGGTGGCGCTCCTGGTGCACAAGATGGAG
GCCAATGCCAGCTTTATCCAAGAGCGGCGCGCCAAAGTAGAGTTTGCTCCACGCGAGCGCGCTCAGGTTGAAGCC
TTCCTCAAGGACTTTGACGTGGCCAAGACGCCGCTTGGTGCGTTTGTGGTGGCGCAGAGGCAGATTCGTGCGCAG
AGAGCTGAGGCGTTTGCCGAGGCACGCAAAGATGATGAGCGGTTGCGGCGCCAAGACGAGACTGGGCAAGAGGTG
GAAAGTGGCGACGAGCATCTTGAACAGGAGATTGGTAGTGACGACGACGATGCGCAGCAGGACGATGAGGGTGAC
GATGACGATGCGCAGCAGGAGGATGAGGGTGACGATGACGATGACGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail