Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|146
Gene name
LocationContig_102:14603..17609
Strand-
Gene length (bp)3006
Transcript length (bp)2943
Coding sequence length (bp)2943
Protein length (aa) 981

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09427 DUF2014 Domain of unknown function (DUF2014) 3.2E-105 558 820
PF00010 HLH Helix-loop-helix DNA-binding domain 2.0E-17 216 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 216 322 1.0E-25
sp|O43019|SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre2 PE=1 SV=1 216 317 4.0E-20
sp|Q59RL7|CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH2 PE=1 SV=1 213 307 1.0E-19
sp|Q12398|HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS1 PE=1 SV=1 217 292 9.0E-16
sp|Q5AL36|TYE7_CANAL Carbohydrate metabolism regulator TYE7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TYE7 PE=1 SV=1 172 307 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 216 322 1.0E-25
sp|O43019|SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre2 PE=1 SV=1 216 317 4.0E-20
sp|Q59RL7|CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH2 PE=1 SV=1 213 307 1.0E-19
sp|Q12398|HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS1 PE=1 SV=1 217 292 9.0E-16
sp|Q5AL36|TYE7_CANAL Carbohydrate metabolism regulator TYE7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TYE7 PE=1 SV=1 172 307 3.0E-11
sp|Q60416|SRBP1_CRIGR Sterol regulatory element-binding protein 1 OS=Cricetulus griseus GN=SREBF1 PE=2 SV=1 216 304 5.0E-09
sp|O97676|SRBP1_PIG Sterol regulatory element-binding protein 1 OS=Sus scrofa GN=SREBF1 PE=2 SV=2 216 304 7.0E-09
sp|P36956|SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens GN=SREBF1 PE=1 SV=2 216 307 9.0E-09
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 455 813 1.0E-08
sp|P56720|SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus GN=Srebf1 PE=1 SV=3 216 304 1.0E-08
sp|Q9WTN3|SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus GN=Srebf1 PE=1 SV=4 216 304 2.0E-08
sp|Q6GQ26|SRBP2_XENLA Sterol regulatory element-binding protein 2 OS=Xenopus laevis GN=srebf2 PE=2 SV=1 216 304 3.0E-08
sp|A3KNA7|SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio GN=srebf2 PE=2 SV=1 216 304 4.0E-08
sp|Q12772|SRBP2_HUMAN Sterol regulatory element-binding protein 2 OS=Homo sapiens GN=SREBF2 PE=1 SV=2 216 304 1.0E-07
sp|Q3U1N2|SRBP2_MOUSE Sterol regulatory element-binding protein 2 OS=Mus musculus GN=Srebf2 PE=1 SV=2 216 304 1.0E-07
sp|Q60429|SRBP2_CRIGR Sterol regulatory element-binding protein 2 OS=Cricetulus griseus GN=SREBF2 PE=2 SV=1 216 304 1.0E-07
sp|Q3T1I5|SRBP2_RAT Sterol regulatory element-binding protein 2 OS=Rattus norvegicus GN=Srebf2 PE=2 SV=1 216 304 1.0E-07
sp|P33122|TYE7_YEAST Serine-rich protein TYE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYE7 PE=1 SV=1 214 298 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0032933 SREBP signaling pathway Yes
GO:0045944 positive regulation of transcription by RNA polymerase II Yes
GO:0010604 positive regulation of macromolecule metabolic process No
GO:0006950 response to stress No
GO:0008150 biological_process No
GO:0006984 ER-nucleus signaling pathway No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0009893 positive regulation of metabolic process No
GO:0010468 regulation of gene expression No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0045893 positive regulation of transcription, DNA-templated No
GO:0006357 regulation of transcription by RNA polymerase II No
GO:0007165 signal transduction No
GO:0071501 cellular response to sterol depletion No
GO:1902680 positive regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0031325 positive regulation of cellular metabolic process No
GO:0033554 cellular response to stress No
GO:0050794 regulation of cellular process No
GO:0048522 positive regulation of cellular process No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0006991 response to sterol depletion No
GO:0051252 regulation of RNA metabolic process No
GO:0009891 positive regulation of biosynthetic process No
GO:0051716 cellular response to stimulus No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051254 positive regulation of RNA metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1903508 positive regulation of nucleic acid-templated transcription No
GO:0051173 positive regulation of nitrogen compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0031328 positive regulation of cellular biosynthetic process No
GO:0045935 positive regulation of nucleobase-containing compound metabolic process No
GO:0050896 response to stimulus No
GO:0065007 biological regulation No
GO:0048518 positive regulation of biological process No
GO:0009987 cellular process No
GO:0009889 regulation of biosynthetic process No
GO:0010557 positive regulation of macromolecule biosynthetic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|146
MSEDDGTSRYGLGEQVFGFMDESAAVADMKPDGSNAPTDNNTQQFYPSSGWDFPVNAQFDSFDVGSAAAAAAAAS
QGQAGSVTPSWQVPPSFEQQQGQPPPAASPPFDEFTPSHVSPGTAYVSGPGRPQVSHPQMRTVSGLSHEELRHIA
MPPHLQYNSPRSASSPDSANSETKMGMGSSPELMGSMAAKKDSRKRKVTDELEEDDDVDDVDKPVKKTAHNMIEK
RYRTNINDKIAALRDSVPSLRIMSKSARGEDTTEDREELHGLTPAHKLNKATVLSKATEYIRHLEKRNSRLMDEN
SAMKERIAAFEKLFMAGAMNGSISPMQHPPTPMQYPQESQQQQYTGSPMTTPPDGNQNAAGLIPVPDDMKRIITA
SGAVGQPYAVPQQPFRGGNPAVIRQQQIQQQQQQQQMQQNGWVNASPYFGKLMVGSLAGLMILEAVRENEVSSDK
PEGRGLFALPMHLLGHASSTLNLHVMGYHVHTSLKLLFFLGAFLWVFVPSLFAQPGEKLEKQEAASLKRAPSLAS
SIHVRRNAWLTAIQTVWVPRHNFFLEASALILKTIKLSLRNAIGVHGYQMLTGLTEEWETARVKAWSIALDSQLA
GGDADICTSRLMLTLLASGTLPDTPARLMLKALHIRILLWDVGNRNWQLGAVNVIAAKLARNRWNEARQLNRLLV
QLRRGSSAAHDNELPAHLVALVEQECDEVLSAPVIQRAHNLAFNVDTAHNVKSHIDGMGMVVDDTAMGSPMDAVA
AWWSTKTLHDILKDTLHHDTHHADNTSQRMELAIKVAPIGSVAQIRAIVARAFLLKESRPDHIAAARQALCTDKM
ASDFGNPGLVINPSPHIYDWDLAISLNCAVAIESTTGAKTPTRPEVRRRHDLVDMMTKPESMSSMTLLGFTARME
LMRHLLSCDVSREEFHLTLAKMSSNLRFWMGKTGATKCGVTPQLRTKLVERCLAATKTLSGPENDTGYGSLSDAE
ESEDE*
Coding >OphauG2|146
ATGTCGGAAGACGACGGCACGAGCCGTTACGGCCTCGGGGAGCAAGTCTTTGGATTTATGGATGAATCAGCAGCC
GTTGCCGACATGAAGCCAGATGGCTCCAATGCTCCCACTGACAACAACACGCAGCAATTCTATCCGTCGTCTGGC
TGGGACTTTCCCGTCAATGCTCAATTCGACTCTTTTGACGTCGGCTCGGCTGCTGCTGCTGCTGCTGCTGCTTCT
CAGGGCCAGGCGGGCTCTGTGACGCCTTCATGGCAGGTGCCGCCATCGTTTGAACAGCAGCAAGGACAGCCACCG
CCGGCCGCTTCTCCACCATTTGACGAATTTACGCCTTCGCACGTCAGTCCGGGAACGGCATATGTCTCTGGCCCG
GGCAGGCCCCAAGTATCTCATCCCCAAATGCGGACAGTCTCTGGTCTCTCTCACGAGGAGCTTCGGCATATCGCC
ATGCCACCTCACTTGCAGTATAACTCTCCCAGAAGTGCCTCTAGCCCAGACTCGGCAAACAGCGAGACCAAGATG
GGCATGGGATCCTCTCCCGAACTAATGGGATCTATGGCTGCCAAGAAGGACAGCCGCAAACGCAAGGTTACCGAT
GAGCTGGAGGAGGACGACGATGTAGATGACGTGGACAAGCCGGTCAAGAAGACAGCTCACAACATGATTGAGAAG
AGGTATCGCACGAACATCAACGACAAAATTGCGGCGCTGCGAGACAGCGTTCCTAGTCTGCGCATCATGTCCAAG
AGCGCACGGGGCGAAGACACCACGGAAGATCGCGAGGAGCTTCATGGACTAACCCCGGCCCACAAGTTGAATAAA
GCAACGGTGTTGAGCAAAGCGACCGAGTACATTCGCCATCTGGAAAAGCGCAACAGTCGATTAATGGACGAAAAC
AGCGCCATGAAGGAACGAATTGCGGCCTTTGAGAAGCTCTTTATGGCTGGGGCCATGAATGGCTCGATTAGTCCG
ATGCAACACCCACCGACGCCCATGCAGTACCCCCAAGAAAGCCAGCAGCAGCAGTACACGGGCTCGCCCATGACA
ACACCGCCAGACGGAAACCAAAACGCAGCGGGATTGATTCCTGTTCCCGATGACATGAAGCGCATCATTACGGCA
TCGGGAGCGGTTGGTCAGCCGTATGCCGTGCCTCAGCAGCCGTTTCGAGGAGGCAATCCGGCTGTGATTCGCCAG
CAGCAGATTCAGCAACAGCAGCAGCAGCAACAGATGCAGCAGAATGGCTGGGTCAATGCCAGTCCGTATTTTGGC
AAGCTCATGGTGGGCTCTCTGGCGGGCCTCATGATTCTTGAGGCTGTTCGCGAGAATGAAGTGAGCTCGGACAAG
CCAGAAGGCCGCGGTCTCTTTGCCCTGCCCATGCACCTCTTGGGCCACGCATCATCGACGCTCAATCTCCACGTC
ATGGGCTACCACGTGCACACGTCTCTCAAGCTTTTGTTTTTCCTGGGGGCCTTTCTCTGGGTCTTTGTCCCGTCG
CTCTTTGCGCAGCCTGGGGAGAAGCTGGAGAAGCAGGAAGCGGCCAGCTTGAAACGCGCGCCGTCGTTGGCGTCG
TCGATCCACGTGCGGCGCAACGCATGGCTGACGGCCATCCAGACGGTCTGGGTGCCTCGGCACAACTTTTTCCTC
GAGGCATCTGCGCTGATACTCAAGACGATCAAGCTCAGCCTGCGGAATGCCATTGGCGTGCACGGCTACCAGATG
CTGACGGGGCTGACGGAGGAGTGGGAGACGGCCCGAGTCAAGGCGTGGTCCATTGCCCTTGACTCGCAGCTGGCG
GGCGGCGATGCCGACATTTGCACCAGCCGCCTGATGCTCACGCTGCTTGCCTCGGGCACTCTGCCCGACACGCCG
GCGCGCCTGATGCTCAAGGCGCTGCACATTCGCATTCTGCTCTGGGACGTGGGCAACCGCAACTGGCAGCTGGGC
GCCGTCAATGTCATTGCCGCCAAGCTGGCGCGCAACCGGTGGAACGAGGCGCGCCAGCTCAATCGCCTGCTGGTT
CAGCTGCGCCGCGGCTCGTCGGCTGCCCACGACAACGAATTGCCTGCCCACCTGGTGGCCCTGGTGGAGCAAGAG
TGCGACGAGGTGCTGAGTGCCCCCGTCATCCAGCGAGCCCACAACCTGGCCTTTAATGTCGACACGGCCCACAAT
GTCAAGTCGCACATCGACGGCATGGGCATGGTTGTCGACGACACCGCCATGGGCTCGCCAATGGATGCCGTGGCT
GCCTGGTGGTCCACAAAGACGCTCCATGACATCCTCAAGGATACACTGCACCACGACACCCACCACGCGGACAAC
ACGTCGCAGCGCATGGAGCTGGCCATCAAGGTGGCCCCCATTGGCTCCGTGGCCCAGATTCGCGCCATTGTTGCC
CGCGCCTTCTTGCTCAAGGAGTCGCGCCCAGACCACATTGCCGCCGCCCGCCAAGCCTTGTGCACCGACAAGATG
GCCAGCGACTTTGGCAACCCTGGGCTCGTCATCAACCCCTCTCCCCACATCTATGACTGGGACCTGGCCATAAGC
CTCAACTGTGCCGTGGCTATTGAAAGCACCACTGGCGCCAAGACGCCCACCCGCCCCGAGGTGCGACGACGCCAC
GACCTGGTGGACATGATGACCAAGCCAGAGTCCATGTCGTCCATGACTCTGCTGGGCTTCACCGCCCGCATGGAG
CTGATGAGGCACCTGCTCAGCTGCGACGTGTCGAGAGAGGAGTTTCACCTGACCCTGGCCAAGATGTCTAGCAAC
CTGCGCTTTTGGATGGGCAAGACGGGCGCAACAAAATGTGGCGTCACGCCACAACTTCGCACCAAGCTTGTTGAG
CGCTGTCTTGCTGCCACAAAGACGCTCTCGGGGCCCGAAAACGACACGGGCTACGGCAGCTTAAGCGATGCCGAA
GAATCAGAAGACGAGTGA
Transcript >OphauG2|146
ATGTCGGAAGACGACGGCACGAGCCGTTACGGCCTCGGGGAGCAAGTCTTTGGATTTATGGATGAATCAGCAGCC
GTTGCCGACATGAAGCCAGATGGCTCCAATGCTCCCACTGACAACAACACGCAGCAATTCTATCCGTCGTCTGGC
TGGGACTTTCCCGTCAATGCTCAATTCGACTCTTTTGACGTCGGCTCGGCTGCTGCTGCTGCTGCTGCTGCTTCT
CAGGGCCAGGCGGGCTCTGTGACGCCTTCATGGCAGGTGCCGCCATCGTTTGAACAGCAGCAAGGACAGCCACCG
CCGGCCGCTTCTCCACCATTTGACGAATTTACGCCTTCGCACGTCAGTCCGGGAACGGCATATGTCTCTGGCCCG
GGCAGGCCCCAAGTATCTCATCCCCAAATGCGGACAGTCTCTGGTCTCTCTCACGAGGAGCTTCGGCATATCGCC
ATGCCACCTCACTTGCAGTATAACTCTCCCAGAAGTGCCTCTAGCCCAGACTCGGCAAACAGCGAGACCAAGATG
GGCATGGGATCCTCTCCCGAACTAATGGGATCTATGGCTGCCAAGAAGGACAGCCGCAAACGCAAGGTTACCGAT
GAGCTGGAGGAGGACGACGATGTAGATGACGTGGACAAGCCGGTCAAGAAGACAGCTCACAACATGATTGAGAAG
AGGTATCGCACGAACATCAACGACAAAATTGCGGCGCTGCGAGACAGCGTTCCTAGTCTGCGCATCATGTCCAAG
AGCGCACGGGGCGAAGACACCACGGAAGATCGCGAGGAGCTTCATGGACTAACCCCGGCCCACAAGTTGAATAAA
GCAACGGTGTTGAGCAAAGCGACCGAGTACATTCGCCATCTGGAAAAGCGCAACAGTCGATTAATGGACGAAAAC
AGCGCCATGAAGGAACGAATTGCGGCCTTTGAGAAGCTCTTTATGGCTGGGGCCATGAATGGCTCGATTAGTCCG
ATGCAACACCCACCGACGCCCATGCAGTACCCCCAAGAAAGCCAGCAGCAGCAGTACACGGGCTCGCCCATGACA
ACACCGCCAGACGGAAACCAAAACGCAGCGGGATTGATTCCTGTTCCCGATGACATGAAGCGCATCATTACGGCA
TCGGGAGCGGTTGGTCAGCCGTATGCCGTGCCTCAGCAGCCGTTTCGAGGAGGCAATCCGGCTGTGATTCGCCAG
CAGCAGATTCAGCAACAGCAGCAGCAGCAACAGATGCAGCAGAATGGCTGGGTCAATGCCAGTCCGTATTTTGGC
AAGCTCATGGTGGGCTCTCTGGCGGGCCTCATGATTCTTGAGGCTGTTCGCGAGAATGAAGTGAGCTCGGACAAG
CCAGAAGGCCGCGGTCTCTTTGCCCTGCCCATGCACCTCTTGGGCCACGCATCATCGACGCTCAATCTCCACGTC
ATGGGCTACCACGTGCACACGTCTCTCAAGCTTTTGTTTTTCCTGGGGGCCTTTCTCTGGGTCTTTGTCCCGTCG
CTCTTTGCGCAGCCTGGGGAGAAGCTGGAGAAGCAGGAAGCGGCCAGCTTGAAACGCGCGCCGTCGTTGGCGTCG
TCGATCCACGTGCGGCGCAACGCATGGCTGACGGCCATCCAGACGGTCTGGGTGCCTCGGCACAACTTTTTCCTC
GAGGCATCTGCGCTGATACTCAAGACGATCAAGCTCAGCCTGCGGAATGCCATTGGCGTGCACGGCTACCAGATG
CTGACGGGGCTGACGGAGGAGTGGGAGACGGCCCGAGTCAAGGCGTGGTCCATTGCCCTTGACTCGCAGCTGGCG
GGCGGCGATGCCGACATTTGCACCAGCCGCCTGATGCTCACGCTGCTTGCCTCGGGCACTCTGCCCGACACGCCG
GCGCGCCTGATGCTCAAGGCGCTGCACATTCGCATTCTGCTCTGGGACGTGGGCAACCGCAACTGGCAGCTGGGC
GCCGTCAATGTCATTGCCGCCAAGCTGGCGCGCAACCGGTGGAACGAGGCGCGCCAGCTCAATCGCCTGCTGGTT
CAGCTGCGCCGCGGCTCGTCGGCTGCCCACGACAACGAATTGCCTGCCCACCTGGTGGCCCTGGTGGAGCAAGAG
TGCGACGAGGTGCTGAGTGCCCCCGTCATCCAGCGAGCCCACAACCTGGCCTTTAATGTCGACACGGCCCACAAT
GTCAAGTCGCACATCGACGGCATGGGCATGGTTGTCGACGACACCGCCATGGGCTCGCCAATGGATGCCGTGGCT
GCCTGGTGGTCCACAAAGACGCTCCATGACATCCTCAAGGATACACTGCACCACGACACCCACCACGCGGACAAC
ACGTCGCAGCGCATGGAGCTGGCCATCAAGGTGGCCCCCATTGGCTCCGTGGCCCAGATTCGCGCCATTGTTGCC
CGCGCCTTCTTGCTCAAGGAGTCGCGCCCAGACCACATTGCCGCCGCCCGCCAAGCCTTGTGCACCGACAAGATG
GCCAGCGACTTTGGCAACCCTGGGCTCGTCATCAACCCCTCTCCCCACATCTATGACTGGGACCTGGCCATAAGC
CTCAACTGTGCCGTGGCTATTGAAAGCACCACTGGCGCCAAGACGCCCACCCGCCCCGAGGTGCGACGACGCCAC
GACCTGGTGGACATGATGACCAAGCCAGAGTCCATGTCGTCCATGACTCTGCTGGGCTTCACCGCCCGCATGGAG
CTGATGAGGCACCTGCTCAGCTGCGACGTGTCGAGAGAGGAGTTTCACCTGACCCTGGCCAAGATGTCTAGCAAC
CTGCGCTTTTGGATGGGCAAGACGGGCGCAACAAAATGTGGCGTCACGCCACAACTTCGCACCAAGCTTGTTGAG
CGCTGTCTTGCTGCCACAAAGACGCTCTCGGGGCCCGAAAACGACACGGGCTACGGCAGCTTAAGCGATGCCGAA
GAATCAGAAGACGAGTGA
Gene >OphauG2|146
ATGTCGGAAGACGACGGCACGAGCCGTTACGGCCTCGGGGAGCAAGTCTTTGGATTTATGGATGAATCAGCAGCC
GTTGCCGACATGAAGCCAGATGGCTCCAATGCTCCCACTGACAACAACACGCAGCAATTCTATCCGTCGTCTGGC
TGGGACTTTCCCGTCAATGCTCAATTCGACTCTTTTGACGTCGGCTCGGCTGCTGCTGCTGCTGCTGCTGCTTCT
CAGGGCCAGGCGGGCTCTGTGACGCCTTCATGGCAGGTGCCGCCATCGTTTGAACAGCAGCAAGGACAGCCACCG
CCGGCCGCTTCTCCACCATTTGACGAATTTACGCCTTCGCACGTCAGTCCGGGAACGGCATATGTCTCTGGCCCG
GGCAGGCCCCAAGTATCTCATCCCCAAATGCGGACAGTCTCTGGTCTCTCTCACGAGGAGCTTCGGCATATCGCC
ATGCCACCTCACTTGCAGTATAACTCTCCCAGAAGTGCCTCTAGCCCAGACTCGGCAAACAGCGAGACCAAGATG
GGCATGGGATCCTCTCCCGAACTAATGGGATCTATGGCTGCCAAGAAGGACAGCCGCAAACGCAAGGTTACCGAT
GAGCTGGAGGAGGACGACGATGTAGATGACGTGGACAAGCCGGTCAAGAAGACAGCTCACAACATGATTGAGAAG
AGGTATCGCACGAACATCAACGACAAAATTGCGGCGCTGCGAGACAGCGTTCCTAGTCTGCGCATCATGTCCAAG
AGCGCACGGGGCGAAGACACCACGGAAGATCGCGAGGAGCTTCATGGACTAACCCCGGCCCACAAGTTGAATAAA
GCAACGGTCAGTAGCGGCTTGTTACGGGAGGTATGTCATGGGTTTGGTTGTTGCTGACAACAGGGGTAGGTGTTG
AGCAAAGCGACCGAGTACATTCGCCATCTGGAAAAGCGCAACAGTCGATTAATGGACGAAAACAGCGCCATGAAG
GAACGAATTGCGGCCTTTGAGAAGCTCTTTATGGCTGGGGCCATGAATGGCTCGATTAGTCCGATGCAACACCCA
CCGACGCCCATGCAGTACCCCCAAGAAAGCCAGCAGCAGCAGTACACGGGCTCGCCCATGACAACACCGCCAGAC
GGAAACCAAAACGCAGCGGGATTGATTCCTGTTCCCGATGACATGAAGCGCATCATTACGGCATCGGGAGCGGTT
GGTCAGCCGTATGCCGTGCCTCAGCAGCCGTTTCGAGGAGGCAATCCGGCTGTGATTCGCCAGCAGCAGATTCAG
CAACAGCAGCAGCAGCAACAGATGCAGCAGAATGGCTGGGTCAATGCCAGTCCGTATTTTGGCAAGCTCATGGTG
GGCTCTCTGGCGGGCCTCATGATTCTTGAGGCTGTTCGCGAGAATGAAGTGAGCTCGGACAAGCCAGAAGGCCGC
GGTCTCTTTGCCCTGCCCATGCACCTCTTGGGCCACGCATCATCGACGCTCAATCTCCACGTCATGGGCTACCAC
GTGCACACGTCTCTCAAGCTTTTGTTTTTCCTGGGGGCCTTTCTCTGGGTCTTTGTCCCGTCGCTCTTTGCGCAG
CCTGGGGAGAAGCTGGAGAAGCAGGAAGCGGCCAGCTTGAAACGCGCGCCGTCGTTGGCGTCGTCGATCCACGTG
CGGCGCAACGCATGGCTGACGGCCATCCAGACGGTCTGGGTGCCTCGGCACAACTTTTTCCTCGAGGCATCTGCG
CTGATACTCAAGACGATCAAGCTCAGCCTGCGGAATGCCATTGGCGTGCACGGCTACCAGATGCTGACGGGGCTG
ACGGAGGAGTGGGAGACGGCCCGAGTCAAGGCGTGGTCCATTGCCCTTGACTCGCAGCTGGCGGGCGGCGATGCC
GACATTTGCACCAGCCGCCTGATGCTCACGCTGCTTGCCTCGGGCACTCTGCCCGACACGCCGGCGCGCCTGATG
CTCAAGGCGCTGCACATTCGCATTCTGCTCTGGGACGTGGGCAACCGCAACTGGCAGCTGGGCGCCGTCAATGTC
ATTGCCGCCAAGCTGGCGCGCAACCGGTGGAACGAGGCGCGCCAGCTCAATCGCCTGCTGGTTCAGCTGCGCCGC
GGCTCGTCGGCTGCCCACGACAACGAATTGCCTGCCCACCTGGTGGCCCTGGTGGAGCAAGAGTGCGACGAGGTG
CTGAGTGCCCCCGTCATCCAGCGAGCCCACAACCTGGCCTTTAATGTCGACACGGCCCACAATGTCAAGTCGCAC
ATCGACGGCATGGGCATGGTTGTCGACGACACCGCCATGGGCTCGCCAATGGATGCCGTGGCTGCCTGGTGGTCC
ACAAAGACGCTCCATGACATCCTCAAGGATACACTGCACCACGACACCCACCACGCGGACAACACGTCGCAGCGC
ATGGAGCTGGCCATCAAGGTGGCCCCCATTGGCTCCGTGGCCCAGATTCGCGCCATTGTTGCCCGCGCCTTCTTG
CTCAAGGAGTCGCGCCCAGACCACATTGCCGCCGCCCGCCAAGCCTTGTGCACCGACAAGATGGCCAGCGACTTT
GGCAACCCTGGGCTCGTCATCAACCCCTCTCCCCACATCTATGACTGGGACCTGGCCATAAGCCTCAACTGTGCC
GTGGCTATTGAAAGCACCACTGGCGCCAAGACGCCCACCCGCCCCGAGGTGCGACGACGCCACGACCTGGTGGAC
ATGATGACCAAGCCAGAGTCCATGTCGTCCATGACTCTGCTGGGCTTCACCGCCCGCATGGAGCTGATGAGGCAC
CTGCTCAGCTGCGACGTGTCGAGAGAGGAGTTTCACCTGACCCTGGCCAAGATGTCTAGCAACCTGCGCTTTTGG
ATGGGCAAGACGGGCGCAACAAAATGTGGCGTCACGCCACAACTTCGCACCAAGCTTGTTGAGCGCTGTCTTGCT
GCCACAAAGACGCTCTCGGGGCCCGAAAACGACACGGGCTACGGCAGCTTAAGCGATGCCGAAGAATCAGAAGAC
GAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail