Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1459
Gene name
LocationContig_144:14734..16562
Strand-
Gene length (bp)1828
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 7.7E-76 90 362
PF00585 Thr_dehydrat_C C-terminal regulatory domain of Threonine dehydratase 2.9E-14 397 491
PF00585 Thr_dehydrat_C C-terminal regulatory domain of Threonine dehydratase 2.4E-19 496 584

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94634|THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1677.03c PE=3 SV=1 49 585 0.0E+00
sp|O42615|THDH_BLAAD Threonine dehydratase, mitochondrial OS=Blastobotrys adeninivorans GN=ILV1 PE=3 SV=1 27 583 0.0E+00
sp|P00927|THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV1 PE=1 SV=2 58 585 0.0E+00
sp|P53607|ILVA_BURM1 L-threonine dehydratase biosynthetic IlvA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ilvA PE=3 SV=1 75 584 7.0E-151
sp|P46493|ILVA_HAEIN L-threonine dehydratase biosynthetic IlvA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvA PE=3 SV=1 75 585 9.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94634|THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1677.03c PE=3 SV=1 49 585 0.0E+00
sp|O42615|THDH_BLAAD Threonine dehydratase, mitochondrial OS=Blastobotrys adeninivorans GN=ILV1 PE=3 SV=1 27 583 0.0E+00
sp|P00927|THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV1 PE=1 SV=2 58 585 0.0E+00
sp|P53607|ILVA_BURM1 L-threonine dehydratase biosynthetic IlvA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ilvA PE=3 SV=1 75 584 7.0E-151
sp|P46493|ILVA_HAEIN L-threonine dehydratase biosynthetic IlvA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvA PE=3 SV=1 75 585 9.0E-145
sp|Q9CKJ2|ILVA_PASMU L-threonine dehydratase biosynthetic IlvA OS=Pasteurella multocida (strain Pm70) GN=ilvA PE=3 SV=1 75 584 4.0E-142
sp|Q9ZSS6|THD1_ARATH Threonine dehydratase biosynthetic, chloroplastic OS=Arabidopsis thaliana GN=OMR1 PE=1 SV=1 84 584 4.0E-133
sp|P04968|ILVA_ECOLI L-threonine dehydratase biosynthetic IlvA OS=Escherichia coli (strain K12) GN=ilvA PE=1 SV=1 75 584 8.0E-133
sp|P20506|ILVA_SALTY L-Threonine dehydratase biosynthetic IlvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvA PE=3 SV=3 75 584 4.0E-131
sp|P25306|THD1_SOLLC Threonine dehydratase biosynthetic, chloroplastic OS=Solanum lycopersicum GN=TD PE=1 SV=1 85 582 6.0E-119
sp|Q39469|THD1_CICAR Threonine dehydratase biosynthetic, chloroplastic OS=Cicer arietinum PE=2 SV=1 70 582 2.0E-106
sp|Q5HMF5|ILVA_STAEQ L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ilvA PE=3 SV=1 102 471 3.0E-74
sp|Q8CNK9|ILVA_STAES L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ilvA PE=3 SV=2 102 471 3.0E-74
sp|P31212|THD1_SOLTU Threonine dehydratase biosynthetic (Fragment) OS=Solanum tuberosum GN=TD PE=2 SV=1 218 582 9.0E-72
sp|Q49Z16|ILVA_STAS1 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvA PE=3 SV=1 80 454 1.0E-65
sp|P37946|ILVA_BACSU L-threonine dehydratase biosynthetic IlvA OS=Bacillus subtilis (strain 168) GN=ilvA PE=3 SV=1 59 485 8.0E-64
sp|Q4L7U4|ILVA_STAHJ L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ilvA PE=3 SV=1 80 467 1.0E-62
sp|Q9KC63|ILVA_BACHD L-threonine dehydratase biosynthetic IlvA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ilvA PE=3 SV=1 94 485 1.0E-62
sp|Q7A4H2|ILVA_STAAN L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain N315) GN=ilvA PE=3 SV=1 80 472 4.0E-62
sp|Q99SJ1|ILVA_STAAM L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ilvA PE=3 SV=1 80 472 4.0E-62
sp|Q3V7T4|ILVA_STAAS L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MSSA476) GN=ilvA PE=3 SV=1 80 472 6.0E-62
sp|Q8NVI8|ILVA_STAAW L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MW2) GN=ilvA PE=3 SV=1 80 472 6.0E-62
sp|Q5HEE0|ILVA_STAAC L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain COL) GN=ilvA PE=3 SV=1 80 472 7.0E-62
sp|Q2FWJ9|ILVA_STAA8 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain NCTC 8325) GN=ilvA PE=3 SV=1 80 472 7.0E-62
sp|Q2FF63|ILVA_STAA3 L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain USA300) GN=ilvA PE=3 SV=1 80 472 7.0E-62
sp|Q3V7T5|ILVA_STAAR L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain MRSA252) GN=ilvA PE=3 SV=1 80 472 1.0E-61
sp|Q2YUE8|ILVA_STAAB L-threonine dehydratase biosynthetic IlvA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ilvA PE=3 SV=1 80 472 5.0E-61
sp|Q02145|ILVA_LACLA L-threonine dehydratase biosynthetic IlvA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvA PE=3 SV=3 102 478 2.0E-53
sp|Q5HFY5|TDCB_STAAC L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain COL) GN=tdcB PE=3 SV=1 80 398 4.0E-48
sp|Q2FH01|TDCB_STAA3 L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain USA300) GN=tdcB PE=3 SV=1 80 398 4.0E-48
sp|Q2FYJ3|TDCB_STAA8 L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain NCTC 8325) GN=tdcB PE=3 SV=1 80 398 4.0E-48
sp|Q6GGX0|TDCB_STAAR L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MRSA252) GN=tdcB PE=3 SV=1 80 398 4.0E-48
sp|Q6G9C4|TDCB_STAAS L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MSSA476) GN=tdcB PE=3 SV=1 80 398 4.0E-48
sp|Q8NWQ4|TDCB_STAAW L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain MW2) GN=tdcB PE=3 SV=1 80 398 4.0E-48
sp|Q74FW6|TSAL_GEOSL L-threonine ammonia-lyase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tdcB PE=1 SV=1 79 427 6.0E-48
sp|Q2YY67|TDCB_STAAB L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tdcB PE=3 SV=2 80 399 4.0E-47
sp|Q7A5L8|TDCB_STAAN L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain N315) GN=tdcB PE=1 SV=1 80 399 3.0E-46
sp|Q99U50|TDCB_STAAM L-threonine dehydratase catabolic TdcB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tdcB PE=3 SV=1 80 399 3.0E-46
sp|Q9X7F1|ILVA_MYCLE L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium leprae (strain TN) GN=ilvA PE=3 SV=1 80 478 9.0E-45
sp|P66898|ILVA_MYCBO L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvA PE=3 SV=1 83 478 2.0E-44
sp|P9WG94|ILVA_MYCTO L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvA PE=3 SV=1 83 478 2.0E-44
sp|P9WG95|ILVA_MYCTU L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvA PE=1 SV=1 83 478 2.0E-44
sp|Q04513|ILVA_CORGL L-threonine dehydratase biosynthetic IlvA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvA PE=3 SV=2 80 472 2.0E-43
sp|P0AGF6|TDCB_ECOLI L-threonine dehydratase catabolic TdcB OS=Escherichia coli (strain K12) GN=tdcB PE=1 SV=1 86 392 1.0E-41
sp|P0AGF7|TDCB_ECOL6 L-threonine dehydratase catabolic TdcB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdcB PE=3 SV=1 86 392 1.0E-41
sp|P0AGF8|TDCB_ECO57 L-threonine dehydratase catabolic TdcB OS=Escherichia coli O157:H7 GN=tdcB PE=3 SV=1 86 392 1.0E-41
sp|P0AGF9|TDCB_SHIFL L-threonine dehydratase catabolic TdcB OS=Shigella flexneri GN=tdcB PE=3 SV=1 86 392 1.0E-41
sp|P36007|SRY1_YEAST Threo-3-hydroxyaspartate ammonia-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRY1 PE=1 SV=1 83 406 2.0E-41
sp|P11954|TDCB_SALTY L-threonine dehydratase catabolic TdcB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tdcB PE=1 SV=2 94 392 1.0E-40
sp|O59791|SRR_SCHPO Serine racemase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SRR PE=1 SV=1 80 391 1.0E-40
sp|Q7XSN8|SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica GN=SERR PE=1 SV=2 72 392 1.0E-38
sp|A2XWA9|SRR_ORYSI Serine racemase OS=Oryza sativa subsp. indica GN=OsI_16936 PE=3 SV=1 72 392 1.0E-38
sp|P55664|Y4TJ_RHISN Putative threonine dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a01490 PE=3 SV=1 77 395 3.0E-36
sp|Q2PGG3|SRR_ARATH Serine racemase OS=Arabidopsis thaliana GN=SR PE=1 SV=1 94 392 7.0E-36
sp|Q9GZT4|SRR_HUMAN Serine racemase OS=Homo sapiens GN=SRR PE=1 SV=1 86 389 9.0E-34
sp|Q10725|FSDH_RALPI Phenylserine dehydratase OS=Ralstonia pickettii GN=psdht PE=1 SV=3 74 360 1.0E-33
sp|A0JNI4|SRR_BOVIN Serine racemase OS=Bos taurus GN=SRR PE=2 SV=1 96 398 3.0E-33
sp|Q54HH2|SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum GN=srr PE=3 SV=1 77 392 3.0E-31
sp|Q76EQ0|SRR_RAT Serine racemase OS=Rattus norvegicus GN=Srr PE=1 SV=1 86 398 1.0E-29
sp|Q9QZX7|SRR_MOUSE Serine racemase OS=Mus musculus GN=Srr PE=1 SV=1 86 398 3.0E-28
sp|Q8R238|SDSL_MOUSE Serine dehydratase-like OS=Mus musculus GN=Sdsl PE=1 SV=1 92 360 6.0E-25
sp|Q8VBT2|SDHL_MOUSE L-serine dehydratase/L-threonine deaminase OS=Mus musculus GN=Sds PE=1 SV=3 94 402 9.0E-21
sp|Q96GA7|SDSL_HUMAN Serine dehydratase-like OS=Homo sapiens GN=SDSL PE=1 SV=1 93 403 1.0E-19
sp|P20132|SDHL_HUMAN L-serine dehydratase/L-threonine deaminase OS=Homo sapiens GN=SDS PE=1 SV=2 94 398 1.0E-17
sp|P09367|SDHL_RAT L-serine dehydratase/L-threonine deaminase OS=Rattus norvegicus GN=Sds PE=1 SV=3 94 403 2.0E-15
sp|B5VKE8|SDHL_YEAS6 L-serine dehydratase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SDL1 PE=3 SV=1 94 401 4.0E-15
sp|P0CF23|SDH1_YEASX L-serine dehydratase OS=Saccharomyces cerevisiae GN=SDL1 PE=3 SV=1 94 392 4.0E-15
sp|C8ZAU6|SDHL_YEAS8 L-serine dehydratase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SDL1 PE=3 SV=1 94 392 8.0E-15
sp|B3LU13|SDHL_YEAS1 L-serine dehydratase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SDL1 PE=3 SV=1 94 392 8.0E-15
sp|P25379|STDH_YEAST Catabolic L-serine/threonine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHA1 PE=1 SV=2 111 320 1.0E-14
sp|A6ZVB1|SDHL_YEAS7 L-serine dehydratase OS=Saccharomyces cerevisiae (strain YJM789) GN=SDL1 PE=3 SV=1 94 392 4.0E-14
sp|Q86B06|SDHL_DICDI L-serine dehydratase OS=Dictyostelium discoideum GN=sds PE=3 SV=1 110 360 7.0E-14
sp|Q0VCW4|SDHL_BOVIN L-serine dehydratase/L-threonine deaminase OS=Bos taurus GN=SDS PE=2 SV=1 99 402 1.0E-13
sp|Q58860|THRC_METJA Threonine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thrC PE=3 SV=1 94 384 2.0E-10
sp|B3PYT5|SDHD_RHIE6 Probable D-serine dehydratase OS=Rhizobium etli (strain CIAT 652) GN=dsdA PE=3 SV=1 46 359 1.0E-09
sp|Q8TQD4|THRC_METAC Threonine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thrC PE=1 SV=1 94 384 6.0E-09
sp|P40817|DPAL_SALTY Diaminopropionate ammonia-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dpaL PE=1 SV=3 145 291 7.0E-08
sp|P0CF22|YI167_YEAST Putative truncated L-serine dehydratase SDL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDL1 PE=5 SV=1 216 392 1.0E-07
sp|B5ZNC1|SDHD_RHILW Probable D-serine dehydratase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dsdA PE=3 SV=1 89 359 2.0E-07
sp|Q9K7E3|THRC_BACHD Threonine synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thrC PE=3 SV=1 101 366 3.0E-07
sp|A6UB95|SDHD_SINMW Probable D-serine dehydratase OS=Sinorhizobium medicae (strain WSM419) GN=dsdA PE=3 SV=1 114 376 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1459 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7875
Ophiocordyceps camponoti-floridani Ophcf2|01046
Ophiocordyceps camponoti-rufipedis Ophun1|3856
Ophiocordyceps kimflemingae Ophio5|2741
Ophiocordyceps subramaniannii Hirsu2|929

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1459
MPSLSPSPMHQAATNGASDGLVHGDDMTRPQTPAGAMALTEYSANPSPPPTSDRAKTRMRELLPPDLLLADGYPD
YLRLIAGATSRVYEACRVTELTRAVNLSSRLGCNVLLKREDTQPVFSFKLRGAYNKMAHLDPAVSWKGVVCCSAG
NHAQGVAYSARKLKIPATIIMPEGTPAIKHRNVSRLGGHVVLHGADFDAAKEECARRAKQDGLINIPPFDDPYVI
AGQGTIGNELFSQVNMAKVEAIFCCCGGGGLIAGVGLYVKRMAPHVKVIGVEAHDANALVQSLRKDQRVLLKEVG
LFADGAAVKTMGEETFRIARDVVDEVIEVTTDQICAAIKDMYDDTRSGLEPAGAMSIAGLKKYVASHPSSSYDCD
RSLIAVTSGANMDFDRLRFVAERASLGEGKEVLLAVSIAERPGAFAKLVDAIMPHAVTEFSYRWATGDSANMLIG
LSLTAPTPRRDDELRTLLERIRLDGMRVLDVSKDELAKSHVRYLVGGRANVPNERLYMFSFPERPGALERFLLAL
RPRFNISVFHYRNYGGDIAKVLAGISCPEDDSAELSRFLDEVGYPFDECTHSDVFNMFLRA*
Coding >OphauG2|1459
ATGCCCTCCCTCAGCCCGTCGCCAATGCATCAAGCAGCCACCAATGGCGCAAGCGACGGCCTGGTCCATGGCGAC
GACATGACGAGGCCTCAGACACCGGCCGGCGCAATGGCCTTGACCGAGTACAGCGCCAATCCGTCGCCGCCGCCC
ACGTCGGACCGGGCCAAGACTCGCATGAGAGAGCTGCTCCCTCCCGACCTGCTGCTGGCCGACGGGTATCCCGAT
TATCTGCGCCTGATTGCCGGTGCAACGTCACGCGTCTACGAGGCCTGTCGTGTCACGGAGCTGACCAGAGCCGTC
AACCTCAGCAGTCGCCTCGGCTGCAATGTGCTGCTCAAGCGCGAGGACACACAGCCCGTCTTCAGCTTCAAACTG
CGCGGCGCCTACAACAAAATGGCCCATCTCGACCCAGCCGTGTCTTGGAAGGGCGTCGTGTGCTGTTCGGCCGGC
AATCATGCCCAAGGCGTCGCCTACTCGGCACGCAAGCTCAAAATACCTGCCACCATCATCATGCCCGAGGGCACG
CCCGCCATCAAGCACCGCAACGTGTCGCGCCTGGGCGGCCATGTTGTCTTGCACGGCGCTGACTTTGATGCCGCC
AAGGAGGAATGCGCGCGCAGGGCCAAGCAGGACGGGCTCATCAACATACCGCCCTTTGACGACCCCTACGTTATT
GCCGGCCAGGGCACCATTGGCAACGAGCTGTTCAGCCAGGTCAACATGGCAAAGGTCGAGGCCATCTTTTGCTGC
TGCGGCGGCGGCGGGCTGATTGCTGGCGTTGGTCTCTATGTCAAACGCATGGCGCCCCATGTCAAGGTGATTGGC
GTCGAGGCGCATGATGCAAACGCCCTGGTCCAGTCGCTCAGAAAAGACCAGCGCGTGCTACTCAAGGAAGTCGGG
CTTTTTGCCGACGGCGCGGCCGTCAAGACCATGGGGGAAGAAACATTTCGCATTGCCCGCGACGTCGTGGACGAG
GTGATTGAGGTTACCACGGACCAAATCTGCGCCGCCATCAAGGACATGTATGACGATACGCGCAGCGGCCTCGAG
CCGGCCGGAGCCATGTCTATTGCAGGCCTCAAGAAGTATGTGGCTAGCCATCCGTCGTCATCATATGATTGCGAC
CGAAGCCTCATTGCCGTCACCTCGGGCGCAAACATGGACTTTGACCGATTACGCTTCGTTGCAGAGCGCGCATCG
CTAGGCGAGGGCAAGGAGGTGCTGCTAGCCGTGTCCATAGCAGAGCGGCCGGGTGCCTTTGCCAAACTGGTCGAC
GCCATCATGCCACATGCCGTGACTGAGTTTTCCTACAGGTGGGCCACGGGCGACAGTGCCAATATGCTTATTGGC
CTGTCGCTGACGGCGCCGACGCCACGGCGCGACGACGAGTTGCGCACACTGCTGGAGCGCATCCGGCTCGATGGC
ATGCGGGTGCTCGACGTGTCTAAAGACGAGCTGGCAAAAAGCCACGTGCGATATCTCGTGGGTGGACGCGCCAAC
GTGCCCAACGAGCGGCTCTACATGTTTAGCTTCCCCGAGCGTCCAGGGGCGCTGGAAAGATTTTTGCTGGCGCTA
CGGCCGCGCTTCAACATTAGTGTCTTTCATTATCGCAACTACGGTGGCGACATTGCCAAGGTGTTGGCCGGCATC
TCGTGCCCAGAAGACGACTCGGCCGAGCTGTCGCGCTTCCTCGACGAAGTTGGCTATCCTTTTGACGAGTGCACC
CACTCCGACGTTTTCAACATGTTTTTGCGGGCATGA
Transcript >OphauG2|1459
ATGCCCTCCCTCAGCCCGTCGCCAATGCATCAAGCAGCCACCAATGGCGCAAGCGACGGCCTGGTCCATGGCGAC
GACATGACGAGGCCTCAGACACCGGCCGGCGCAATGGCCTTGACCGAGTACAGCGCCAATCCGTCGCCGCCGCCC
ACGTCGGACCGGGCCAAGACTCGCATGAGAGAGCTGCTCCCTCCCGACCTGCTGCTGGCCGACGGGTATCCCGAT
TATCTGCGCCTGATTGCCGGTGCAACGTCACGCGTCTACGAGGCCTGTCGTGTCACGGAGCTGACCAGAGCCGTC
AACCTCAGCAGTCGCCTCGGCTGCAATGTGCTGCTCAAGCGCGAGGACACACAGCCCGTCTTCAGCTTCAAACTG
CGCGGCGCCTACAACAAAATGGCCCATCTCGACCCAGCCGTGTCTTGGAAGGGCGTCGTGTGCTGTTCGGCCGGC
AATCATGCCCAAGGCGTCGCCTACTCGGCACGCAAGCTCAAAATACCTGCCACCATCATCATGCCCGAGGGCACG
CCCGCCATCAAGCACCGCAACGTGTCGCGCCTGGGCGGCCATGTTGTCTTGCACGGCGCTGACTTTGATGCCGCC
AAGGAGGAATGCGCGCGCAGGGCCAAGCAGGACGGGCTCATCAACATACCGCCCTTTGACGACCCCTACGTTATT
GCCGGCCAGGGCACCATTGGCAACGAGCTGTTCAGCCAGGTCAACATGGCAAAGGTCGAGGCCATCTTTTGCTGC
TGCGGCGGCGGCGGGCTGATTGCTGGCGTTGGTCTCTATGTCAAACGCATGGCGCCCCATGTCAAGGTGATTGGC
GTCGAGGCGCATGATGCAAACGCCCTGGTCCAGTCGCTCAGAAAAGACCAGCGCGTGCTACTCAAGGAAGTCGGG
CTTTTTGCCGACGGCGCGGCCGTCAAGACCATGGGGGAAGAAACATTTCGCATTGCCCGCGACGTCGTGGACGAG
GTGATTGAGGTTACCACGGACCAAATCTGCGCCGCCATCAAGGACATGTATGACGATACGCGCAGCGGCCTCGAG
CCGGCCGGAGCCATGTCTATTGCAGGCCTCAAGAAGTATGTGGCTAGCCATCCGTCGTCATCATATGATTGCGAC
CGAAGCCTCATTGCCGTCACCTCGGGCGCAAACATGGACTTTGACCGATTACGCTTCGTTGCAGAGCGCGCATCG
CTAGGCGAGGGCAAGGAGGTGCTGCTAGCCGTGTCCATAGCAGAGCGGCCGGGTGCCTTTGCCAAACTGGTCGAC
GCCATCATGCCACATGCCGTGACTGAGTTTTCCTACAGGTGGGCCACGGGCGACAGTGCCAATATGCTTATTGGC
CTGTCGCTGACGGCGCCGACGCCACGGCGCGACGACGAGTTGCGCACACTGCTGGAGCGCATCCGGCTCGATGGC
ATGCGGGTGCTCGACGTGTCTAAAGACGAGCTGGCAAAAAGCCACGTGCGATATCTCGTGGGTGGACGCGCCAAC
GTGCCCAACGAGCGGCTCTACATGTTTAGCTTCCCCGAGCGTCCAGGGGCGCTGGAAAGATTTTTGCTGGCGCTA
CGGCCGCGCTTCAACATTAGTGTCTTTCATTATCGCAACTACGGTGGCGACATTGCCAAGGTGTTGGCCGGCATC
TCGTGCCCAGAAGACGACTCGGCCGAGCTGTCGCGCTTCCTCGACGAAGTTGGCTATCCTTTTGACGAGTGCACC
CACTCCGACGTTTTCAACATGTTTTTGCGGGCATGA
Gene >OphauG2|1459
ATGCCCTCCCTCAGCCCGTCGCCAATGCATCAAGCAGCCACCAATGGCGCAAGCGACGGCCTGGTCCATGGCGAC
GACATGACGAGGCCTCAGACACCGGCCGGCGCAATGGCCTTGACCGAGTACAGCGCCAATCCGTCGCCGCCGCCC
ACGTCGGACCGGGCCAAGACTCGCATGAGAGAGCTGCTCCCTCCCGACCTGCTGCTGGCCGACGGGTATCCCGAT
GTAGGTCATGGCATCCATGCTTCTGCCAGCCGCCGCGGCTAATCAAGAATCAACGTTGCTTGCCTAGTATCTGCG
CCTGATTGCCGGTGCAACGTCACGCGTCTACGAGGCCTGTCGTGTCACGGAGCTGACCAGAGCCGTCAACCTCAG
CAGTCGCCTCGGCTGCAATGTGCTGCTCAAGCGCGAGGACACACAGCCCGTCTTCAGCTTCAAACTGCGCGGCGC
CTACAACAAAATGGCCCATCTCGACCCAGCCGTGTCTTGGAAGGGCGTCGTGTGCTGTTCGGCCGGCAATCATGC
CCAAGGCGTCGCCTACTCGGCACGCAAGCTCAAAATACCTGCCACCATCATCATGCCCGAGGGCACGCCCGCCAT
CAAGCACCGCAACGTGTCGCGCCTGGGCGGCCATGTTGTCTTGCACGGCGCTGACTTTGATGCCGCCAAGGAGGA
ATGCGCGCGCAGGGCCAAGCAGGACGGGCTCATCAACATACCGCCCTTTGACGACCCCTACGTTATTGCCGGCCA
GGGCACCATTGGCAACGAGCTGTTCAGCCAGGTCAACATGGCAAAGGTCGAGGCCATCTTTTGCTGCTGCGGCGG
CGGCGGGCTGATTGCTGGCGTTGGTCTCTATGTCAAACGCATGGCGCCCCATGTCAAGGTGATTGGCGTCGAGGC
GCATGATGCAAACGCCCTGGTCCAGTCGCTCAGAAAAGACCAGCGCGTGCTACTCAAGGAAGTCGGGCTTTTTGC
CGACGGCGCGGCCGTCAAGACCATGGGGGAAGAAACATTTCGCATTGCCCGCGACGTCGTGGACGAGGTGATTGA
GGTTACCACGGACCAAATCTGCGCCGCCATCAAGGACATGTATGACGATACGCGCAGCGGCCTCGAGCCGGCCGG
AGCCATGTCTATTGCAGGCCTCAAGAAGTATGTGGCTAGCCATCCGTCGTCATCATATGATTGCGACCGAAGCCT
CATTGCCGTCACCTCGGGCGCAAACATGGACTTTGACCGATTACGCTTCGTTGCAGAGCGCGCATCGCTAGGCGA
GGGCAAGGAGGTGCTGCTAGCCGTGTCCATAGCAGAGCGGCCGGGTGCCTTTGCCAAACTGGTCGACGCCATCAT
GCCACATGCCGTGACTGAGTTTTCCTACAGGTGGGCCACGGGCGACAGTGCCAATATGCTTATTGGCCTGTCGCT
GACGGCGCCGACGCCACGGCGCGACGACGAGTTGCGCACACTGCTGGAGCGCATCCGGCTCGATGGCATGCGGGT
GCTCGACGTGTCTAAAGACGAGCTGGCAAAAAGCCACGTGCGATATCTCGTGGGTGGACGCGCCAACGTGCCCAA
CGAGCGGCTCTACATGTTTAGCTTCCCCGAGCGTCCAGGGGCGCTGGAAAGATTTTTGCTGGCGCTACGGCCGCG
CTTCAACATTAGTGTCTTTCATTATCGCAACTACGGTGGCGACATTGCCAAGGTGTTGGCCGGCATCTCGTGCCC
AGAAGACGACTCGGCCGAGCTGTCGCGCTTCCTCGACGAAGTTGGCTATCCTTTTGACGAGTGCACCCACTCCGA
CGTTTTCAACATGTTTTTGCGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail