Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1450
Gene name
LocationContig_1436:1498..3461
Strand-
Gene length (bp)1963
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05187 ETF_QO Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S 3.2E-49 527 630
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.1E-07 90 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87111|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1 78 633 0.0E+00
sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=1 SV=1 74 630 0.0E+00
sp|P55931|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2 32 630 0.0E+00
sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 74 630 0.0E+00
sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 74 630 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87111|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1 78 633 0.0E+00
sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=1 SV=1 74 630 0.0E+00
sp|P55931|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2 32 630 0.0E+00
sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 74 630 0.0E+00
sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 74 630 0.0E+00
sp|Q2KIG0|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1 74 630 0.0E+00
sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 74 630 0.0E+00
sp|Q54XM6|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1 81 630 0.0E+00
sp|Q11190|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=3 SV=2 81 630 0.0E+00
sp|O22854|ETFQO_ARATH Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Arabidopsis thaliana GN=ETFQO PE=2 SV=1 76 632 0.0E+00
sp|Q337B8|ETFQO_ORYSJ Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Oryza sativa subsp. japonica GN=Os10g0516300 PE=3 SV=1 81 630 0.0E+00
sp|Q08822|ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIR2 PE=1 SV=1 81 633 0.0E+00
sp|Q9HZP5|ETFD_PSEAE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2953 PE=1 SV=1 79 630 9.0E-180
sp|P94132|ETFD_ACIAD Probable electron transfer flavoprotein-ubiquinone oxidoreductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=etfD PE=3 SV=1 78 630 3.0E-171
sp|P26484|FIXC_AZOC5 Protein FixC OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixC PE=3 SV=2 84 474 4.0E-25
sp|P77337|YDIS_ECOLI Probable electron transfer flavoprotein-quinone oxidoreductase YdiS OS=Escherichia coli (strain K12) GN=ydiS PE=3 SV=1 84 476 3.0E-24
sp|Q53208|FIXC_RHISN Protein FixC OS=Rhizobium sp. (strain NGR234) GN=fixC PE=3 SV=1 84 475 1.0E-23
sp|P09820|FIXC_RHIME Protein FixC OS=Rhizobium meliloti (strain 1021) GN=fixC PE=3 SV=1 84 475 9.0E-19
sp|Q8Z9K9|FIXC_SALTI Protein FixC OS=Salmonella typhi GN=fixC PE=3 SV=1 84 476 2.0E-18
sp|Q8ZRW9|FIXC_SALTY Protein FixC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fixC PE=3 SV=1 84 476 2.0E-18
sp|P10331|FIXC_BRADU Protein FixC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixC PE=3 SV=2 116 475 2.0E-18
sp|Q83SQ7|FIXC_SHIFL Protein FixC OS=Shigella flexneri GN=fixC PE=3 SV=1 84 410 2.0E-16
sp|P68644|FIXC_ECOLI Protein FixC OS=Escherichia coli (strain K12) GN=fixC PE=3 SV=1 84 410 2.0E-16
sp|P68645|FIXC_ECOL6 Protein FixC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fixC PE=3 SV=1 84 410 2.0E-16
sp|Q7AHT0|FIXC_ECO57 Protein FixC OS=Escherichia coli O157:H7 GN=fixC PE=3 SV=1 84 410 7.0E-16
sp|P53572|FIXC_AZOVI Protein FixC OS=Azotobacter vinelandii GN=fixC PE=3 SV=1 116 475 1.0E-14
sp|Q46904|YGCN_ECOLI Probable electron transfer flavoprotein-quinone oxidoreductase YgcN OS=Escherichia coli (strain K12) GN=ygcN PE=3 SV=2 116 476 8.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1685
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1450 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3376
Ophiocordyceps camponoti-floridani Ophcf2|01211
Ophiocordyceps camponoti-rufipedis Ophun1|5127
Ophiocordyceps kimflemingae Ophio5|5598
Ophiocordyceps subramaniannii Hirsu2|1459

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1450
MAAPARCLERSSTRAISAISSWPLRRFALGPPCCLIAATNTARAPVPSRAPWQIRSARALTTTTPVGAPDEAGFD
ASSVERESDQVDVCIVGGGPAGLSAAIRLKQLANAADNKDFRVLVLEKAGDMGAHILSGAVIQPSALDQLLPDWL
DPSNPNRFAHATPAGKDCMRFLTRTASIPIPAPPQMNNHGNYIVSLNQFIKWLAERAEELGVEVYPGFAASEVLY
DAADGAVRGVATNDLGIARNGKPKDTFERGMEFHARVTMFGEGCHGSLSKQVINKFDLRKDSQHQTYGLGLKEVW
EVDPQKFEEGLIVHSMGYPLPRNVYGGSFMYHFGDNLVSLGLVVSLDYSNPWLSPYQEFQKLKHHPLFKSVIEGG
KCISYGARALIEGGFQSIPKVAFPGGALIGDSAGFVNVPKVKGTHNAMKSGMLAAEAAWTAINQSSDGTVFLYDY
EDSLRKSSIWKELKEVRNMRPSFHNPLGLYGGVAYSGLEAYIFKGRVPWTLKHKTPDYASTKPADQCPKIEYDKP
DGKISFDILTSVSRTGTNHEEDQPVHLQVKDWDAHTKSTYPAFKGVENRFCPAGVYEYVDDDTKPLGVRFQINAQ
NCIHCKTCDIKAPKQDINWQVPQGGEGPKYYMT*
Coding >OphauG2|1450
ATGGCGGCCCCGGCCCGCTGTCTTGAGCGCAGCAGCACCAGAGCCATTTCAGCCATTTCATCATGGCCACTAAGA
CGCTTCGCCCTCGGCCCGCCCTGCTGCCTCATAGCCGCAACAAACACAGCCAGGGCCCCCGTTCCCTCTCGAGCT
CCGTGGCAAATACGCAGTGCCCGGGCCTTGACCACAACCACGCCCGTCGGCGCTCCCGACGAGGCTGGCTTTGAT
GCATCGAGCGTCGAGCGCGAGTCGGACCAGGTCGACGTCTGCATCGTCGGCGGCGGCCCAGCCGGCCTCAGCGCC
GCCATCCGCCTCAAGCAGCTTGCCAACGCCGCCGACAACAAAGACTTCCGTGTCCTCGTTCTCGAAAAGGCTGGC
GACATGGGCGCGCATATCCTCTCAGGCGCCGTCATCCAACCCTCTGCCCTCGACCAACTACTCCCCGACTGGCTC
GACCCCTCCAACCCCAATCGCTTTGCCCACGCCACGCCCGCCGGCAAGGACTGCATGCGCTTCCTGACCCGCACC
GCCTCCATTCCCATCCCTGCTCCTCCGCAGATGAATAACCATGGCAACTACATTGTCAGCCTAAACCAGTTCATC
AAGTGGCTCGCCGAGCGCGCAGAAGAGCTGGGCGTCGAGGTCTATCCCGGCTTTGCCGCCTCCGAGGTTCTTTAC
GACGCCGCTGATGGCGCTGTACGTGGCGTTGCCACAAACGACCTCGGCATTGCCCGCAACGGCAAACCAAAGGAC
ACGTTTGAGCGCGGCATGGAGTTTCATGCCCGCGTCACCATGTTTGGCGAAGGCTGTCATGGCAGCTTGAGCAAA
CAAGTCATCAACAAATTCGACTTGCGCAAGGACAGTCAGCACCAGACCTACGGCCTTGGCCTCAAGGAAGTCTGG
GAGGTGGACCCGCAAAAGTTTGAAGAGGGCCTCATTGTTCACTCCATGGGCTACCCCCTGCCCCGAAACGTCTAC
GGCGGCTCATTCATGTATCACTTTGGCGACAATCTTGTCAGTCTGGGACTCGTCGTCTCCCTCGACTACTCAAAT
CCCTGGCTCTCGCCCTATCAAGAATTCCAGAAACTCAAGCACCATCCCTTGTTCAAAAGCGTCATTGAGGGCGGC
AAGTGCATCTCGTACGGTGCTCGTGCTCTCATCGAAGGCGGCTTTCAATCCATCCCCAAAGTTGCCTTTCCGGGA
GGCGCCCTCATCGGCGACTCTGCCGGCTTTGTCAACGTGCCCAAGGTCAAGGGCACACACAACGCCATGAAGTCT
GGCATGCTCGCCGCCGAGGCTGCCTGGACGGCCATCAACCAGAGCAGCGATGGCACAGTCTTTCTTTATGACTAT
GAAGACTCATTACGCAAATCGTCTATTTGGAAGGAGCTCAAGGAGGTGCGCAACATGCGTCCTTCCTTTCACAAT
CCTCTCGGCCTCTATGGAGGCGTCGCCTACTCGGGTCTTGAGGCCTACATCTTCAAAGGCCGCGTTCCTTGGACC
CTCAAGCACAAAACGCCCGACTATGCCAGCACCAAGCCGGCAGACCAGTGCCCCAAGATTGAGTACGATAAGCCC
GATGGCAAAATCAGTTTCGACATTCTCACCAGTGTCTCTCGCACCGGCACAAACCACGAAGAGGATCAGCCCGTC
CATCTGCAGGTCAAGGACTGGGACGCTCACACCAAGTCTACGTATCCTGCCTTCAAGGGCGTCGAAAACCGCTTC
TGCCCTGCTGGCGTTTACGAGTATGTCGATGACGACACCAAGCCGCTTGGCGTTCGGTTTCAAATTAATGCACAA
AATTGTATCCATTGCAAGACTTGCGATATCAAGGCGCCCAAGCAGGATATCAACTGGCAGGTACCACAGGGTGGA
GAAGGTCCCAAGTACTACATGACCTGA
Transcript >OphauG2|1450
ATGGCGGCCCCGGCCCGCTGTCTTGAGCGCAGCAGCACCAGAGCCATTTCAGCCATTTCATCATGGCCACTAAGA
CGCTTCGCCCTCGGCCCGCCCTGCTGCCTCATAGCCGCAACAAACACAGCCAGGGCCCCCGTTCCCTCTCGAGCT
CCGTGGCAAATACGCAGTGCCCGGGCCTTGACCACAACCACGCCCGTCGGCGCTCCCGACGAGGCTGGCTTTGAT
GCATCGAGCGTCGAGCGCGAGTCGGACCAGGTCGACGTCTGCATCGTCGGCGGCGGCCCAGCCGGCCTCAGCGCC
GCCATCCGCCTCAAGCAGCTTGCCAACGCCGCCGACAACAAAGACTTCCGTGTCCTCGTTCTCGAAAAGGCTGGC
GACATGGGCGCGCATATCCTCTCAGGCGCCGTCATCCAACCCTCTGCCCTCGACCAACTACTCCCCGACTGGCTC
GACCCCTCCAACCCCAATCGCTTTGCCCACGCCACGCCCGCCGGCAAGGACTGCATGCGCTTCCTGACCCGCACC
GCCTCCATTCCCATCCCTGCTCCTCCGCAGATGAATAACCATGGCAACTACATTGTCAGCCTAAACCAGTTCATC
AAGTGGCTCGCCGAGCGCGCAGAAGAGCTGGGCGTCGAGGTCTATCCCGGCTTTGCCGCCTCCGAGGTTCTTTAC
GACGCCGCTGATGGCGCTGTACGTGGCGTTGCCACAAACGACCTCGGCATTGCCCGCAACGGCAAACCAAAGGAC
ACGTTTGAGCGCGGCATGGAGTTTCATGCCCGCGTCACCATGTTTGGCGAAGGCTGTCATGGCAGCTTGAGCAAA
CAAGTCATCAACAAATTCGACTTGCGCAAGGACAGTCAGCACCAGACCTACGGCCTTGGCCTCAAGGAAGTCTGG
GAGGTGGACCCGCAAAAGTTTGAAGAGGGCCTCATTGTTCACTCCATGGGCTACCCCCTGCCCCGAAACGTCTAC
GGCGGCTCATTCATGTATCACTTTGGCGACAATCTTGTCAGTCTGGGACTCGTCGTCTCCCTCGACTACTCAAAT
CCCTGGCTCTCGCCCTATCAAGAATTCCAGAAACTCAAGCACCATCCCTTGTTCAAAAGCGTCATTGAGGGCGGC
AAGTGCATCTCGTACGGTGCTCGTGCTCTCATCGAAGGCGGCTTTCAATCCATCCCCAAAGTTGCCTTTCCGGGA
GGCGCCCTCATCGGCGACTCTGCCGGCTTTGTCAACGTGCCCAAGGTCAAGGGCACACACAACGCCATGAAGTCT
GGCATGCTCGCCGCCGAGGCTGCCTGGACGGCCATCAACCAGAGCAGCGATGGCACAGTCTTTCTTTATGACTAT
GAAGACTCATTACGCAAATCGTCTATTTGGAAGGAGCTCAAGGAGGTGCGCAACATGCGTCCTTCCTTTCACAAT
CCTCTCGGCCTCTATGGAGGCGTCGCCTACTCGGGTCTTGAGGCCTACATCTTCAAAGGCCGCGTTCCTTGGACC
CTCAAGCACAAAACGCCCGACTATGCCAGCACCAAGCCGGCAGACCAGTGCCCCAAGATTGAGTACGATAAGCCC
GATGGCAAAATCAGTTTCGACATTCTCACCAGTGTCTCTCGCACCGGCACAAACCACGAAGAGGATCAGCCCGTC
CATCTGCAGGTCAAGGACTGGGACGCTCACACCAAGTCTACGTATCCTGCCTTCAAGGGCGTCGAAAACCGCTTC
TGCCCTGCTGGCGTTTACGAGTATGTCGATGACGACACCAAGCCGCTTGGCGTTCGGTTTCAAATTAATGCACAA
AATTGTATCCATTGCAAGACTTGCGATATCAAGGCGCCCAAGCAGGATATCAACTGGCAGGTACCACAGGGTGGA
GAAGGTCCCAAGTACTACATGACCTGA
Gene >OphauG2|1450
ATGGCGGCCCCGGCCCGCTGTCTTGAGCGCAGCAGCACCAGAGCCATTTCAGCCATTTCATCATGGCCACTAAGA
CGCTTCGCCCTCGGCCCGCCCTGCTGCCTCATAGCCGCAACAAACACAGCCAGGGCCCCCGTTCCCTCTCGAGCT
CCGTGGCAAATACGCAGTGCCCGGGCCTTGACCACAACCACGCCCGTCGGCGCTCCCGACGAGGCTGGCTTTGAT
GCATCGAGCGTCGAGCGCGAGTCGGACCAGGTCGACGTCTGCATCGTCGGCGGCGGCCCAGCCGGCCTCAGCGCC
GCCATCCGCCTCAAGCAGCTTGCCAACGCCGCCGACAACAAAGACTTCCGTGTCCTCGTTCTCGAAAAGGCTGGC
GACATGGGCGCGCATATCCTCTCAGGCGCCGTCATCCAACCCTCTGCCCTCGACCAACTACTCCCCGACTGGCTC
GACCCCTCCAACCCCAATCGCTTTGCCCACGCCACGCCCGCCGGCAAGGACTGCATGCGCTTCCTGACCCGCACC
GCCTCCATTCCCATCCCTGCTCCTCCGCAGATGAATAACCATGGCAACTACATTGTCAGCCTAAACCAGTTCATC
AAGTGGCTCGCCGAGCGCGCAGAAGAGCTGGGCGTCGAGGTCTATCCCGGCTTTGCCGCCTCCGAGGTTCTTTAC
GACGCCGCTGATGGCGCTGTACGTGGCGTTGCCACAAACGACCTCGGCATTGCCCGCAACGGCAAACCAAAGGAC
ACGTTTGAGCGCGGCATGGAGTTTCATGCCCGCGTCACCATGTTTGGCGAAGGCTGTCATGGCAGCTTGAGCAAA
CAAGTCATCAACAAATTCGACTTGCGCAAGGACAGTCAGCACCAGACCTACGGCCTTGGCCTCAAGGAAGTCTGG
GAGGTGGACCCGCAAAAGTTTGAAGAGGGCCTCATTGTTCACTCCATGGGCTACCCCCTGCCCCGAAACGTCTAC
GGCGGCTCATTCATGTATCACTTTGGCGACAATCTTGTCAGTCTGGGACTCGTCGTCTCCCTCGACTACTCAAAT
CCCTGGCTCTCGCCCTATCAAGAATTCCAGAAACTCAAGCACCATCCCTTGTTCAAAAGCGTCATTGAGGGCGGC
AAGTGCATCTCGTACGGTGCTCGTGCTCTCATCGAAGGCGGCTTTCAATCCATCCCCAAAGTTGCCTTTCCGGGA
GGCGCCCTCATCGGCGACTCTGCCGGCTTTGTCAACGTGCCCAAGGTCAAGGGCACACACAACGCCATGAAGTCT
GGCATGCTCGCCGCCGAGGCTGCCTGGACGGCCATCAACCAGAGCAGCGATGGCACAGTCTTTCTTTATGACTAT
GAAGACTCATTACGCAAATCGTCTATTTGGAAGGAGCTCAAGGAGGTGCGCAACATGCGTCCTTCCTTTCACAAT
CCTCTCGGCCTCTATGGAGGCGTCGCCTACTCGGGTCTTGAGGCCTACATCTTCAAAGGCCGCGTTCCTTGGACC
CTCAAGCACAAAACGCCCGACTATGCCAGCACCAAGCCGGCAGACCAGTGCCCCAAGATTGAGTACGATAAGCCC
GATGGCAAAATCAGTTTCGACATTCTCACCAGTGTCTCTCGCACCGGCACAAACCACGAAGAGGATCAGCCCGTC
CATCTGCAGGTCAAGGACTGGGACGCTCACACCAAGTCTACGTATCCTGCCTTCAAGGGCGTCGAAAACCGCTTC
TGCCCTGCTGGCGTTTACGAGTATGTCGATGACGACACCAAGCCGCTTGGCGTTCGGTTTCAAATTAATGCACAA
AAGTAAGTCGGGCCAGATTCGGCGAGGCCACGACAATTTACTGACCAAGCTCACCGCCGTCAGTTGTATCCATTG
CAAGACTTGCGATATCAAGGCGCCCAAGCAGGATATCAACTGGCAGGTACCACAGGGTGGAGAAGGTCCCAAGTA
CTACATGACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail