Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|144
Gene name
LocationContig_102:8775..12287
Strand+
Gene length (bp)3512
Transcript length (bp)3339
Coding sequence length (bp)3339
Protein length (aa) 1113

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.4E-44 12 301
PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain 8.1E-20 672 796
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 2.6E-15 163 245
PF04324 Fer2_BFD BFD-like [2Fe-2S] binding domain 1.6E-11 459 507
PF00355 Rieske Rieske [2Fe-2S] domain 1.5E-06 905 954
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 1.3E-08 599 661

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38681|NIR_NEUCR Nitrite reductase [NAD(P)H] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-6 PE=2 SV=2 10 1093 0.0E+00
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 8 1091 0.0E+00
sp|Q06458|NIRB_KLEOX Nitrite reductase [NAD(P)H] large subunit OS=Klebsiella oxytoca GN=nasB PE=3 SV=1 13 953 0.0E+00
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 10 871 0.0E+00
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 10 835 1.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38681|NIR_NEUCR Nitrite reductase [NAD(P)H] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-6 PE=2 SV=2 10 1093 0.0E+00
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 8 1091 0.0E+00
sp|Q06458|NIRB_KLEOX Nitrite reductase [NAD(P)H] large subunit OS=Klebsiella oxytoca GN=nasB PE=3 SV=1 13 953 0.0E+00
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 10 871 0.0E+00
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 10 835 1.0E-130
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 9 812 2.0E-78
sp|P43504|NIR_LEPMC Nitrite reductase [NAD(P)H] (Fragment) OS=Leptosphaeria maculans GN=NIIA PE=3 SV=1 24 124 1.0E-34
sp|Q05805|SIR_DESVH Sulfite reductase, assimilatory-type OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_1597 PE=4 SV=2 598 808 2.0E-34
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 13 303 3.0E-23
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 12 300 2.0E-22
sp|Q7MFY7|NORW_VIBVY Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain YJ016) GN=norW PE=3 SV=1 13 377 3.0E-22
sp|Q8D4F7|NORW_VIBVU Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain CMCP6) GN=norW PE=3 SV=1 13 377 7.0E-22
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 13 303 2.0E-21
sp|P37337|BPHG_BURXL Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia xenovorans (strain LB400) GN=bphG PE=3 SV=2 13 303 4.0E-21
sp|Q8L3B0|PADH_AZOEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 9 296 1.0E-20
sp|B5FG80|NORW_VIBFM Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain MJ11) GN=norW PE=3 SV=1 13 325 9.0E-18
sp|P0C621|TODA_PSEPU Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=todA PE=3 SV=1 13 299 1.0E-17
sp|P08087|BNZD_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=bnzD PE=3 SV=3 13 299 1.0E-17
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 13 303 4.0E-17
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 13 345 5.0E-17
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 13 345 1.0E-16
sp|Q9AL95|NROR_CLOAB NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nroR PE=1 SV=1 9 358 1.0E-16
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 13 345 2.0E-16
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 13 345 2.0E-16
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 13 345 2.0E-16
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 13 345 3.0E-16
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 13 345 4.0E-16
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 13 345 5.0E-16
sp|Q5E3X0|NORW_VIBF1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norW PE=3 SV=2 13 346 5.0E-16
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 8 308 5.0E-16
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 13 345 5.0E-16
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 13 345 6.0E-16
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 13 345 8.0E-16
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 13 345 8.0E-16
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 13 345 8.0E-16
sp|A8GG95|NORW_SERP5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Serratia proteamaculans (strain 568) GN=norW PE=3 SV=1 13 346 8.0E-16
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 13 345 8.0E-16
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 13 345 9.0E-16
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 13 345 9.0E-16
sp|B7N6U1|NORW_ECOLU Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 13 345 9.0E-16
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 13 345 9.0E-16
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 13 345 9.0E-16
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 13 345 9.0E-16
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 13 345 9.0E-16
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 13 345 2.0E-15
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 13 345 2.0E-15
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 13 345 2.0E-15
sp|B5XVA0|NORW_KLEP3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 13 346 3.0E-15
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 13 345 3.0E-15
sp|A6TCX6|NORW_KLEP7 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 13 346 3.0E-15
sp|Q0S032|BPHA4_RHOJR Biphenyl 2,3-dioxygenase, ferredoxin reductase component OS=Rhodococcus jostii (strain RHA1) GN=bphA4 PE=1 SV=1 41 303 6.0E-15
sp|A8ANR8|NORW_CITK8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 13 325 1.0E-14
sp|A9MFX5|NORW_SALAR Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=norW PE=3 SV=1 13 325 1.0E-14
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 13 345 1.0E-14
sp|A4WDR7|NORW_ENT38 Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 13 346 2.0E-14
sp|B1LNJ8|HCAD_ECOSM 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 9 301 2.0E-14
sp|B7NRJ1|HCAD_ECO7I 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 9 301 3.0E-14
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 13 345 3.0E-14
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 41 314 4.0E-14
sp|B7N6C9|HCAD_ECOLU 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 9 301 5.0E-14
sp|Q9LK94|MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana GN=MDAR4 PE=1 SV=1 41 309 5.0E-14
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 13 345 6.0E-14
sp|Q0VTB0|RURE_ALCBS Rubredoxin-NAD(+) reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rubB PE=1 SV=1 13 325 2.0E-13
sp|B5F365|NORW_SALA4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella agona (strain SL483) GN=norW PE=3 SV=1 13 325 3.0E-13
sp|B5Z115|HCAD_ECO5E 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 9 301 3.0E-13
sp|Q8XA71|HCAD_ECO57 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 9 301 3.0E-13
sp|Q9L4M8|RURE_PSEPU Rubredoxin-NAD(+) reductase OS=Pseudomonas putida GN=alkT PE=3 SV=1 13 309 5.0E-13
sp|B6I5B5|HCAD_ECOSE 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 9 301 6.0E-13
sp|B7LDD4|HCAD_ECO55 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 9 301 6.0E-13
sp|P77650|HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) GN=hcaD PE=1 SV=1 9 301 8.0E-13
sp|B1IVT5|HCAD_ECOLC 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hcaD PE=3 SV=1 9 301 8.0E-13
sp|A8A348|HCAD_ECOHS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O9:H4 (strain HS) GN=hcaD PE=3 SV=1 9 301 8.0E-13
sp|B1XB17|HCAD_ECODH 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / DH10B) GN=hcaD PE=3 SV=1 9 301 8.0E-13
sp|C4ZXB7|HCAD_ECOBW 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hcaD PE=3 SV=1 9 301 8.0E-13
sp|P17052|RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=1 SV=1 13 301 1.0E-12
sp|Q9HTK9|RURE_PSEAE Rubredoxin-NAD(+) reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=alkT PE=1 SV=1 8 326 1.0E-12
sp|B5RDG6|NORW_SALG2 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=norW PE=3 SV=1 13 325 1.0E-12
sp|A7ZPY5|HCAD_ECO24 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hcaD PE=3 SV=1 9 301 2.0E-12
sp|Q3YZ11|HCAD_SHISS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella sonnei (strain Ss046) GN=hcaD PE=3 SV=1 9 301 2.0E-12
sp|B4TF25|NORW_SALHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella heidelberg (strain SL476) GN=norW PE=3 SV=1 13 325 3.0E-12
sp|B5QV90|NORW_SALEP Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=norW PE=3 SV=1 13 325 3.0E-12
sp|A9N0E0|NORW_SALPB Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=norW PE=3 SV=1 13 325 4.0E-12
sp|B4TT18|NORW_SALSV Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=norW PE=3 SV=1 13 325 4.0E-12
sp|B5FSZ2|NORW_SALDC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella dublin (strain CT_02021853) GN=norW PE=3 SV=1 13 325 5.0E-12
sp|B4T3B2|NORW_SALNS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella newport (strain SL254) GN=norW PE=3 SV=1 13 325 5.0E-12
sp|Q8ZMJ6|NORW_SALTY Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=norW PE=3 SV=1 13 325 6.0E-12
sp|Q8Z4C4|NORW_SALTI Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhi GN=norW PE=3 SV=1 13 325 7.0E-12
sp|B5BEP9|NORW_SALPK Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=norW PE=3 SV=1 13 325 7.0E-12
sp|Q5PF36|NORW_SALPA Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=norW PE=3 SV=1 13 325 7.0E-12
sp|Q43497|MDAR_SOLLC Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 72 303 8.0E-12
sp|C0PWN3|NORW_SALPC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi C (strain RKS4594) GN=norW PE=3 SV=1 13 325 8.0E-12
sp|Q57KT2|NORW_SALCH Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella choleraesuis (strain SC-B67) GN=norW PE=3 SV=1 13 325 8.0E-12
sp|A0KEJ2|NORW_AERHH Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=norW PE=3 SV=1 11 346 1.0E-11
sp|Q0T1X7|HCAD_SHIF8 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella flexneri serotype 5b (strain 8401) GN=hcaD PE=3 SV=1 9 301 1.0E-11
sp|Q40977|MDAR_PEA Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 75 303 1.0E-11
sp|P33009|TERPA_PSESP Terpredoxin reductase OS=Pseudomonas sp. GN=terPA PE=4 SV=1 41 302 4.0E-11
sp|Q7N4V5|HCAD_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 41 300 8.0E-11
sp|A4STH3|NORW_AERS4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 11 346 2.0E-10
sp|Q84BZ0|ANDAA_BURCE Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 14 300 7.0E-10
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 85 331 8.0E-10
sp|Q93WJ8|MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 41 303 1.0E-09
sp|D5IGG6|FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 6 308 2.0E-09
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 104 302 3.0E-09
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 13 303 2.0E-08
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 12 304 3.0E-08
sp|Q58280|Y870_METJA Uncharacterized protein MJ0870 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0870 PE=3 SV=1 601 734 4.0E-08
sp|Q9SR59|MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 41 309 1.0E-07
sp|P42454|RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 106 331 2.0E-07
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 13 303 3.0E-07
sp|Q5XC60|NAOX_STRP6 Probable NADH oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0868 PE=1 SV=1 12 304 5.0E-07
sp|Q42711|MDARS_CUCSA Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 75 303 8.0E-07
sp|Q9Z0X1|AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus GN=Aifm1 PE=1 SV=1 41 309 1.0E-06
sp|A5IRE8|CDR_STAA9 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH9) GN=cdr PE=3 SV=1 87 304 2.0E-06
sp|A6U077|CDR_STAA2 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH1) GN=cdr PE=3 SV=1 87 304 2.0E-06
sp|Q9JM53|AIFM1_RAT Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus GN=Aifm1 PE=1 SV=1 41 309 2.0E-06
sp|Q4L4Y7|CDR_STAHJ Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 11 302 2.0E-06
sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens GN=AIFM1 PE=1 SV=1 41 309 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0020037 heme binding Yes
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0051540 metal cluster binding No
GO:0097159 organic cyclic compound binding No
GO:0046906 tetrapyrrole binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|144 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|497
Ophiocordyceps subramaniannii Hirsu2|7462

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|144
MNLLPMENKRQRVVVVGLGMVGIAFIEKLLQYDAQAQAYTITVLGEEPHLAYNRVGLTSFFKHREIESLYLQSSE
WYAKVPDGTLEYHISTRVDSIKSDKKTVVCQNGDEVAYDILVLATGSEALLPRQTPGFNAHGVFVYRTIKDLTSL
IDFCNTKKGTVGAVVGGGLLGLEAAKAMMDLEAFASVKLMERNQWLLSRQLDQDAGAMVVQQVRDLGLDVMLSKR
VQRIKVDGNNSVIGVVFEDGQATDCSTICFAIGVRSRDELARKSGLECAQGGGGGIVVDDHLSTTHAGIYAIGEC
ASWHGETFGLIAPGIEMADILAFNLTQAKLHSCRKFNQPDLSTKLKLLGVNVASFGDFFADRDGPKHIPPRLAKK
QSCDRNVKTLTYKDPFDNVYKKYIFTADGKYLIGGMMIGDTMDYVKLVPMARKMKELQVPPNQLILGTRKDGDQG
EDLDDDCQVCSCHNVTKRDIIQCVKDGKAKDLAGVKACTKAGTGCGGCMPLVTTIFNQTMAALGNEVKNYLCPHF
NLCRAELYHIIMVKRLKRLSDVMREAGTNSDSSGCEVCKPAVASIFASLWNGHVMGKDMHGLQDTNDRFLGNIQR
DGTYSVVPRVSGGEIAPEWLIVMGDVARQYGLYTKITGGQRIDMFGARKQDLPAIWGRLVEAGMESGHAYAKSLR
TIKSCVGTTWCRYGIGDSVGMAVRLEERYKSIRAPHKIKGGVSGCVRECAEAQSKDFGLIATDKGFNIFVGGNGG
AAPRHGEMLAKDVPPAEVVSIIDRYLMFYIRTADRLQRTARWIENLPGGIKYLQQVVLQDKLGLCASLEAQMREL
VGSFYDEWAEAIRQPSLVSKFRQFANTDEAVEGVERERERGQQRPAHWTREAATQNFASLRHSWTKLVWEPVMAA
AYFDGADDMPNGISATIKRGDTQLAVWRFRGRYYASQQMCPHKRAFVLSDGLLSQGVCNGLGGRDSGLDANGEAA
SEAEHVAKVLSNGNGSEGNPRTSAGAPWISCPQHKRNFNLQNGACQSDEALSIATFGVEQRHDGQIWLHLPPGDE
LDAALGTRRWRVRAGEAGEAQLAQLDTKVRGMLGRRGKKPGATTRMSRPVELITGCGGAPEW*
Coding >OphauG2|144
ATGAATTTGCTACCGATGGAGAATAAACGACAAAGAGTGGTGGTGGTGGGCCTGGGCATGGTAGGCATTGCTTTC
ATCGAAAAATTGCTCCAGTACGATGCTCAAGCTCAAGCATATACAATTACGGTTCTTGGTGAAGAGCCTCATCTA
GCATACAATCGCGTCGGCCTTACCAGCTTCTTTAAGCACCGCGAGATTGAGAGCCTATATTTGCAATCATCTGAG
TGGTACGCAAAAGTTCCAGACGGCACTTTGGAATATCATATCAGCACAAGAGTAGACAGCATCAAGAGTGATAAA
AAGACGGTCGTCTGTCAAAATGGTGACGAGGTTGCGTACGATATCCTCGTCCTGGCCACCGGTTCCGAGGCGCTT
CTCCCGCGGCAGACGCCTGGCTTCAATGCCCATGGCGTCTTCGTATATCGAACCATCAAGGACCTGACGAGTCTG
ATTGACTTTTGCAACACCAAAAAGGGTACCGTGGGTGCGGTTGTTGGCGGCGGACTGCTCGGTCTCGAGGCTGCG
AAAGCCATGATGGATCTCGAGGCCTTTGCATCGGTCAAGCTCATGGAGAGAAACCAGTGGCTTCTCAGTCGGCAG
CTTGACCAGGACGCTGGCGCCATGGTTGTTCAGCAAGTCCGGGACCTCGGCCTCGATGTCATGCTTAGCAAGCGG
GTCCAGCGCATCAAGGTTGATGGCAACAATAGCGTCATTGGCGTCGTTTTTGAAGATGGCCAGGCAACGGATTGT
TCAACAATATGCTTCGCAATTGGTGTCCGCTCAAGGGACGAATTGGCTCGCAAGTCTGGTCTCGAATGTGCACAA
GGCGGTGGCGGCGGAATCGTCGTGGATGACCATCTAAGCACCACCCATGCGGGAATTTATGCCATTGGAGAGTGT
GCCAGCTGGCATGGAGAAACGTTTGGCCTCATCGCACCCGGCATAGAAATGGCTGATATACTTGCCTTTAACCTA
ACGCAGGCCAAGCTACACTCTTGCCGCAAGTTCAATCAACCGGATCTGAGCACCAAGCTGAAACTTCTGGGCGTC
AACGTTGCCAGCTTTGGCGACTTTTTCGCCGACCGAGATGGACCAAAGCATATCCCTCCTCGACTGGCCAAGAAA
CAAAGTTGTGACAGGAACGTCAAAACGCTCACCTACAAGGACCCTTTTGATAACGTGTACAAGAAATATATCTTT
ACGGCGGACGGTAAGTACCTTATCGGCGGTATGATGATTGGAGATACCATGGACTATGTCAAGCTGGTTCCCATG
GCACGAAAGATGAAGGAGCTTCAAGTTCCGCCAAATCAGCTGATTTTAGGAACGCGCAAAGATGGCGACCAAGGG
GAGGATCTGGATGACGATTGCCAAGTGTGTTCGTGCCACAATGTCACCAAGCGCGACATTATTCAGTGTGTCAAG
GATGGCAAGGCCAAAGACTTGGCTGGAGTCAAGGCGTGTACCAAGGCGGGTACGGGATGTGGCGGTTGTATGCCT
TTGGTGACAACAATTTTCAACCAGACCATGGCGGCGCTGGGCAACGAGGTCAAGAATTATTTGTGCCCTCATTTC
AACCTTTGCCGCGCAGAGCTATATCACATCATCATGGTCAAGAGATTGAAGAGACTTAGCGACGTGATGCGCGAG
GCGGGTACCAATAGTGACAGCTCTGGGTGCGAGGTATGCAAGCCAGCCGTGGCCAGCATCTTTGCTTCGCTGTGG
AATGGGCATGTCATGGGTAAGGATATGCATGGGCTCCAGGACACCAATGACCGGTTCCTGGGAAACATTCAGCGT
GACGGAACATACTCGGTGGTGCCACGGGTATCAGGCGGCGAGATTGCCCCTGAGTGGCTTATTGTTATGGGAGAC
GTGGCACGGCAGTACGGTCTCTACACCAAGATCACTGGAGGCCAGCGCATCGACATGTTTGGAGCACGCAAACAG
GATTTGCCGGCCATCTGGGGCCGGTTGGTGGAAGCCGGCATGGAGTCTGGTCACGCCTATGCCAAGTCGTTGCGC
ACCATCAAGAGCTGCGTTGGTACGACATGGTGTCGCTACGGCATTGGCGACAGCGTGGGCATGGCGGTGCGGCTA
GAAGAGCGGTACAAGAGCATCCGGGCACCGCACAAGATTAAAGGGGGGGTGAGCGGCTGTGTGCGGGAGTGCGCC
GAGGCCCAGAGCAAGGATTTTGGCCTTATTGCTACGGACAAGGGCTTCAATATTTTTGTTGGTGGTAACGGCGGA
GCAGCACCGCGACATGGTGAGATGTTGGCCAAGGATGTGCCTCCAGCCGAAGTGGTTTCCATCATCGACCGCTAC
CTCATGTTCTATATCAGGACGGCAGATCGGCTGCAGCGAACGGCACGATGGATCGAGAATCTTCCTGGCGGCATC
AAGTACTTGCAACAGGTGGTGCTACAAGACAAGCTGGGCCTGTGTGCGTCGCTCGAAGCGCAGATGAGGGAACTG
GTGGGCAGTTTCTACGACGAATGGGCAGAGGCGATCCGGCAGCCAAGTTTGGTGTCCAAATTTCGGCAGTTTGCC
AACACGGATGAGGCGGTTGAGGGCGTGGAAAGGGAAAGGGAACGGGGCCAGCAGCGACCAGCCCATTGGACAAGG
GAGGCGGCCACTCAAAACTTTGCAAGCCTCAGGCACAGCTGGACCAAGCTAGTGTGGGAGCCAGTCATGGCAGCA
GCATATTTTGACGGCGCTGACGATATGCCCAATGGAATATCGGCAACGATCAAGAGGGGCGATACACAGCTGGCA
GTGTGGCGATTCCGGGGCCGCTACTATGCCTCGCAACAAATGTGCCCTCACAAGCGAGCCTTTGTCTTATCAGAC
GGCCTATTGAGCCAAGGCGTGTGCAATGGACTGGGCGGGAGAGACTCGGGGCTCGATGCAAATGGAGAAGCTGCT
TCAGAGGCCGAGCACGTTGCCAAGGTCTTGTCCAATGGAAACGGATCCGAGGGCAATCCCCGCACCTCGGCTGGG
GCGCCGTGGATCTCGTGTCCGCAGCACAAGCGTAACTTCAACTTGCAAAACGGCGCCTGCCAGAGCGACGAGGCC
CTTTCGATTGCTACGTTTGGCGTGGAGCAGCGCCATGATGGCCAGATATGGCTGCACCTTCCACCTGGTGACGAG
CTGGACGCAGCGCTTGGAACAAGGCGATGGAGAGTGCGAGCTGGCGAGGCTGGCGAGGCCCAGCTGGCCCAGCTC
GACACCAAGGTCAGAGGCATGCTGGGCAGAAGAGGCAAGAAGCCTGGAGCAACGACGCGCATGTCAAGGCCAGTT
GAGCTCATTACTGGGTGTGGGGGAGCGCCGGAATGGTAA
Transcript >OphauG2|144
ATGAATTTGCTACCGATGGAGAATAAACGACAAAGAGTGGTGGTGGTGGGCCTGGGCATGGTAGGCATTGCTTTC
ATCGAAAAATTGCTCCAGTACGATGCTCAAGCTCAAGCATATACAATTACGGTTCTTGGTGAAGAGCCTCATCTA
GCATACAATCGCGTCGGCCTTACCAGCTTCTTTAAGCACCGCGAGATTGAGAGCCTATATTTGCAATCATCTGAG
TGGTACGCAAAAGTTCCAGACGGCACTTTGGAATATCATATCAGCACAAGAGTAGACAGCATCAAGAGTGATAAA
AAGACGGTCGTCTGTCAAAATGGTGACGAGGTTGCGTACGATATCCTCGTCCTGGCCACCGGTTCCGAGGCGCTT
CTCCCGCGGCAGACGCCTGGCTTCAATGCCCATGGCGTCTTCGTATATCGAACCATCAAGGACCTGACGAGTCTG
ATTGACTTTTGCAACACCAAAAAGGGTACCGTGGGTGCGGTTGTTGGCGGCGGACTGCTCGGTCTCGAGGCTGCG
AAAGCCATGATGGATCTCGAGGCCTTTGCATCGGTCAAGCTCATGGAGAGAAACCAGTGGCTTCTCAGTCGGCAG
CTTGACCAGGACGCTGGCGCCATGGTTGTTCAGCAAGTCCGGGACCTCGGCCTCGATGTCATGCTTAGCAAGCGG
GTCCAGCGCATCAAGGTTGATGGCAACAATAGCGTCATTGGCGTCGTTTTTGAAGATGGCCAGGCAACGGATTGT
TCAACAATATGCTTCGCAATTGGTGTCCGCTCAAGGGACGAATTGGCTCGCAAGTCTGGTCTCGAATGTGCACAA
GGCGGTGGCGGCGGAATCGTCGTGGATGACCATCTAAGCACCACCCATGCGGGAATTTATGCCATTGGAGAGTGT
GCCAGCTGGCATGGAGAAACGTTTGGCCTCATCGCACCCGGCATAGAAATGGCTGATATACTTGCCTTTAACCTA
ACGCAGGCCAAGCTACACTCTTGCCGCAAGTTCAATCAACCGGATCTGAGCACCAAGCTGAAACTTCTGGGCGTC
AACGTTGCCAGCTTTGGCGACTTTTTCGCCGACCGAGATGGACCAAAGCATATCCCTCCTCGACTGGCCAAGAAA
CAAAGTTGTGACAGGAACGTCAAAACGCTCACCTACAAGGACCCTTTTGATAACGTGTACAAGAAATATATCTTT
ACGGCGGACGGTAAGTACCTTATCGGCGGTATGATGATTGGAGATACCATGGACTATGTCAAGCTGGTTCCCATG
GCACGAAAGATGAAGGAGCTTCAAGTTCCGCCAAATCAGCTGATTTTAGGAACGCGCAAAGATGGCGACCAAGGG
GAGGATCTGGATGACGATTGCCAAGTGTGTTCGTGCCACAATGTCACCAAGCGCGACATTATTCAGTGTGTCAAG
GATGGCAAGGCCAAAGACTTGGCTGGAGTCAAGGCGTGTACCAAGGCGGGTACGGGATGTGGCGGTTGTATGCCT
TTGGTGACAACAATTTTCAACCAGACCATGGCGGCGCTGGGCAACGAGGTCAAGAATTATTTGTGCCCTCATTTC
AACCTTTGCCGCGCAGAGCTATATCACATCATCATGGTCAAGAGATTGAAGAGACTTAGCGACGTGATGCGCGAG
GCGGGTACCAATAGTGACAGCTCTGGGTGCGAGGTATGCAAGCCAGCCGTGGCCAGCATCTTTGCTTCGCTGTGG
AATGGGCATGTCATGGGTAAGGATATGCATGGGCTCCAGGACACCAATGACCGGTTCCTGGGAAACATTCAGCGT
GACGGAACATACTCGGTGGTGCCACGGGTATCAGGCGGCGAGATTGCCCCTGAGTGGCTTATTGTTATGGGAGAC
GTGGCACGGCAGTACGGTCTCTACACCAAGATCACTGGAGGCCAGCGCATCGACATGTTTGGAGCACGCAAACAG
GATTTGCCGGCCATCTGGGGCCGGTTGGTGGAAGCCGGCATGGAGTCTGGTCACGCCTATGCCAAGTCGTTGCGC
ACCATCAAGAGCTGCGTTGGTACGACATGGTGTCGCTACGGCATTGGCGACAGCGTGGGCATGGCGGTGCGGCTA
GAAGAGCGGTACAAGAGCATCCGGGCACCGCACAAGATTAAAGGGGGGGTGAGCGGCTGTGTGCGGGAGTGCGCC
GAGGCCCAGAGCAAGGATTTTGGCCTTATTGCTACGGACAAGGGCTTCAATATTTTTGTTGGTGGTAACGGCGGA
GCAGCACCGCGACATGGTGAGATGTTGGCCAAGGATGTGCCTCCAGCCGAAGTGGTTTCCATCATCGACCGCTAC
CTCATGTTCTATATCAGGACGGCAGATCGGCTGCAGCGAACGGCACGATGGATCGAGAATCTTCCTGGCGGCATC
AAGTACTTGCAACAGGTGGTGCTACAAGACAAGCTGGGCCTGTGTGCGTCGCTCGAAGCGCAGATGAGGGAACTG
GTGGGCAGTTTCTACGACGAATGGGCAGAGGCGATCCGGCAGCCAAGTTTGGTGTCCAAATTTCGGCAGTTTGCC
AACACGGATGAGGCGGTTGAGGGCGTGGAAAGGGAAAGGGAACGGGGCCAGCAGCGACCAGCCCATTGGACAAGG
GAGGCGGCCACTCAAAACTTTGCAAGCCTCAGGCACAGCTGGACCAAGCTAGTGTGGGAGCCAGTCATGGCAGCA
GCATATTTTGACGGCGCTGACGATATGCCCAATGGAATATCGGCAACGATCAAGAGGGGCGATACACAGCTGGCA
GTGTGGCGATTCCGGGGCCGCTACTATGCCTCGCAACAAATGTGCCCTCACAAGCGAGCCTTTGTCTTATCAGAC
GGCCTATTGAGCCAAGGCGTGTGCAATGGACTGGGCGGGAGAGACTCGGGGCTCGATGCAAATGGAGAAGCTGCT
TCAGAGGCCGAGCACGTTGCCAAGGTCTTGTCCAATGGAAACGGATCCGAGGGCAATCCCCGCACCTCGGCTGGG
GCGCCGTGGATCTCGTGTCCGCAGCACAAGCGTAACTTCAACTTGCAAAACGGCGCCTGCCAGAGCGACGAGGCC
CTTTCGATTGCTACGTTTGGCGTGGAGCAGCGCCATGATGGCCAGATATGGCTGCACCTTCCACCTGGTGACGAG
CTGGACGCAGCGCTTGGAACAAGGCGATGGAGAGTGCGAGCTGGCGAGGCTGGCGAGGCCCAGCTGGCCCAGCTC
GACACCAAGGTCAGAGGCATGCTGGGCAGAAGAGGCAAGAAGCCTGGAGCAACGACGCGCATGTCAAGGCCAGTT
GAGCTCATTACTGGGTGTGGGGGAGCGCCGGAATGGTAA
Gene >OphauG2|144
ATGAATTTGCTACCGATGGAGAATAAACGACAAAGAGTGGTGGTGGTGGGCCTGGGCATGGTAGGCATTGCTTTC
ATGTGAGTAAATATTGGTGTTTACTTTTTCTGCATGCCATCTGACAGGCTAAGATAGCGAAAAATTGCTCCAGTA
CGATGCTCAAGCTCAAGCATATACAATTACGGTTCTTGGTGAAGAGCCTCATCTAGCATACAATCGCGTCGGCCT
TACCAGCTTCTTTAAGCACCGCGAGATTGAGAGCCTATATTTGCAATCATCTGAGTGGGTATGTGCCTGGATCCT
GCTCGCTCCTCGTCTGCATACCTTCTCACCCTAGTTGCAGTACGCAAAAGTTCCAGACGGCACTTTGGAATATCA
TATCAGCACAAGAGTAGACAGCATCAAGAGTGATAAAAAGACGGTCGTCTGTCAAAATGGTGACGAGGTTGCGTA
CGATATCCTCGTCCTGGCCACCGGTTCCGAGGCGCTTCTCCCGCGGCAGACGCCTGGCTTCAATGCCCATGGCGT
CTTCGTATATCGAACCATCAAGGACCTGACGAGTCTGATTGACTTTTGCAACACCAAAAAGGGTACCGTGGGTGC
GGTTGTTGGCGGCGGACTGCTCGGTCTCGAGGCTGCGAAAGCCATGATGGATCTCGAGGCCTTTGCATCGGTCAA
GCTCATGGAGAGAAACCAGTGGCTTCTCAGTCGGCAGCTTGACCAGGACGCTGGCGCCATGGTTGTTCAGCAAGT
CCGGGACCTCGGCCTCGATGTCATGCTTAGCAAGCGGGTCCAGCGCATCAAGGTTGATGGCAACAATAGCGTCAT
TGGCGTCGTTTTTGAAGATGGCCAGGCAACGGATTGTTCAACAATATGCTTCGCAATTGGTGTCCGCTCAAGGGA
CGAATTGGCTCGCAAGTCTGGTCTCGAATGTGCACAAGGCGGTGGCGGCGGAATCGTCGTGGATGACCATCTAAG
CACCACCCATGCGGGAATTTATGCCATTGGAGAGTGTGCCAGCTGGCATGGAGAAACGTTTGGCCTCATCGCACC
CGGCATAGAAATGGCTGATATACTTGCCTTTAACCTAACGCAGGCCAAGCTACACTCTTGCCGCAAGTTCAATCA
ACCGGATCTGAGCACCAAGCTGAAACTTCTGGGCGTCAACGTTGCCAGCTTTGGCGACTTTTTCGCCGACCGAGA
TGGACCAAAGCATATCCCTCCTCGACTGGCCAAGAAACAAAGTTGTGACAGGAACGTCAAAACGCTCACCTACAA
GGACCCTTTTGATAACGTGTACAAGAAATATATCTTTACGGCGGACGGTAAGTACCTTATCGGCGGTATGATGAT
TGGAGATACCATGGACTATGTCAAGCTGGTTCCCATGGCACGAAAGATGAAGGAGCTTCAAGTTCCGCCAAATCA
GCTGATTTTAGGAACGCGCAAAGATGGCGACCAAGGGGAGGATCTGGATGACGATTGCCAAGTGTGTTCGTGCCA
CAATGTCACCAAGCGCGACATTATTCAGTGTGTCAAGGATGGCAAGGCCAAAGACTTGGCTGGAGTCAAGGCGTG
TACCAAGGCGGGTACGGGATGTGGCGGTTGTATGCCTTTGGTGACAACAATTTTCAACCAGACCATGGCGGCGCT
GGGCAACGAGGTCAAGAATTATTTGTGCCCTCATTTCAACCTTTGCCGCGCAGAGCTATATCACATCATCATGGT
CAAGAGATTGAAGAGACTTAGCGACGTGATGCGCGAGGCGGGTACCAATAGTGACAGCTCTGGGTGCGAGGTATG
CAAGCCAGCCGTGGCCAGCATCTTTGCTTCGCTGTGGAATGGGCATGTCATGGGTAAGGATATGCATGGGCTCCA
GGACACCAATGACCGGTTCCTGGGAAACATTCAGCGTGACGGAACATACTCGGTGGTGCCACGGGTATCAGGCGG
CGAGATTGCCCCTGAGTGGCTTATTGTTATGGGAGACGTGGCACGGCAGTACGGTCTCTACACCAAGATCACTGG
AGGCCAGCGCATCGACATGTTTGGAGCACGCAAACAGGATTTGCCGGCCATCTGGGGCCGGTTGGTGGAAGCCGG
CATGGAGTCTGGTCACGCCTATGCCAAGTCGTTGCGCACCATCAAGAGCTGCGTTGGTACGACATGGTGTCGCTA
CGGCATTGGCGACAGCGTGGGCATGGCGGTGCGGCTAGAAGAGCGGTACAAGAGCATCCGGGCACCGCACAAGAT
TAAAGGGGGGGTGAGCGGCTGTGTGCGGGAGTGCGCCGAGGCCCAGAGCAAGGAGTAAGCTTGCTCCCATGGCCT
TGGAATGTTTTGGAGTGGTTACTGACGAGGGCACGGGCAGTTTTGGCCTTATTGCTACGGACAAGGGCTTCAATA
TTTTTGTTGGTGGTAACGGCGGAGCAGCACCGCGACATGGTGAGATGTTGGCCAAGGATGTGCCTCCAGCCGAAG
TGGTTTCCATCATCGACCGCTACCTCATGTTCTATATCAGGACGGCAGATCGGCTGCAGCGAACGGCACGATGGA
TCGAGAATCTTCCTGGCGGCATCAAGTACTTGCAACAGGTGGTGCTACAAGACAAGCTGGGCCTGTGTGCGTCGC
TCGAAGCGCAGATGAGGGAACTGGTGGGCAGTTTCTACGACGAATGGGCAGAGGCGATCCGGCAGCCAAGTTTGG
TGTCCAAATTTCGGCAGTTTGCCAACACGGATGAGGCGGTTGAGGGCGTGGAAAGGGAAAGGGAACGGGGCCAGC
AGCGACCAGCCCATTGGACAAGGGAGGCGGCCACTCAAAACTTTGCAAGCCTCAGGCACAGCTGGACCAAGCTAG
TGTGGGAGCCAGTCATGGCAGCAGCATATTTTGACGGCGCTGACGATATGCCCAATGGAATATCGGCAACGATCA
AGAGGGGCGATACACAGCTGGCAGTGTGGCGATTCCGGGGCCGCTACTATGCCTCGCAACAAATGTGCCCTCACA
AGCGAGCCTTTGTCTTATCAGACGGCCTATTGAGCCAAGGCGTGTGCAATGGACTGGGCGGGAGAGACTCGGGGC
TCGATGCAAATGGAGAAGCTGCTTCAGAGGCCGAGCACGTTGCCAAGGTCTTGTCCAATGGAAACGGATCCGAGG
GCAATCCCCGCACCTCGGCTGGGGCGCCGTGGATCTCGTGTCCGCAGCACAAGCGTAACTTCAACTTGCAAAACG
GCGCCTGCCAGAGCGACGAGGCCCTTTCGATTGCTACGTTTGGCGTGGAGCAGCGCCATGATGGCCAGATATGGC
TGCACCTTCCACCTGGTGACGAGCTGGACGCAGCGCTTGGAACAAGGCGATGGAGAGTGCGAGCTGGCGAGGCTG
GCGAGGCCCAGCTGGCCCAGCTCGACACCAAGGTCAGAGGCATGCTGGGCAGAAGAGGCAAGAAGCCTGGAGCAA
CGACGCGCATGTCAAGGCCAGTTGAGCTCATTACTGGGTGTGGGGGAGCGCCGGAATGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail