Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1432
Gene name
LocationContig_143:5735..6946
Strand-
Gene length (bp)1211
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19445 eIF3h_C C-terminal region of eIF3h 1.8E-17 146 207
PF19445 eIF3h_C C-terminal region of eIF3h 4.8E-23 238 352
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 4.4E-07 10 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7E7B3|EIF3H_SCLS1 Eukaryotic translation initiation factor 3 subunit H OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_01190 PE=3 SV=1 6 360 0.0E+00
sp|A6RQZ9|EIF3H_BOTFB Eukaryotic translation initiation factor 3 subunit H OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_03240 PE=3 SV=1 4 360 3.0E-180
sp|Q7S9Y9|EIF3H_NEUCR Eukaryotic translation initiation factor 3 subunit H OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3h PE=3 SV=1 1 360 6.0E-180
sp|Q2GZK0|EIF3H_CHAGB Eukaryotic translation initiation factor 3 subunit H OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05046 PE=3 SV=1 26 360 5.0E-178
sp|A4QT78|EIF3H_MAGO7 Eukaryotic translation initiation factor 3 subunit H OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05156 PE=3 SV=1 1 360 5.0E-171
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7E7B3|EIF3H_SCLS1 Eukaryotic translation initiation factor 3 subunit H OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_01190 PE=3 SV=1 6 360 0.0E+00
sp|A6RQZ9|EIF3H_BOTFB Eukaryotic translation initiation factor 3 subunit H OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_03240 PE=3 SV=1 4 360 3.0E-180
sp|Q7S9Y9|EIF3H_NEUCR Eukaryotic translation initiation factor 3 subunit H OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3h PE=3 SV=1 1 360 6.0E-180
sp|Q2GZK0|EIF3H_CHAGB Eukaryotic translation initiation factor 3 subunit H OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05046 PE=3 SV=1 26 360 5.0E-178
sp|A4QT78|EIF3H_MAGO7 Eukaryotic translation initiation factor 3 subunit H OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05156 PE=3 SV=1 1 360 5.0E-171
sp|Q0UMR2|EIF3H_PHANO Eukaryotic translation initiation factor 3 subunit H OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_06952 PE=3 SV=3 1 359 7.0E-170
sp|Q1DHB6|EIF3H_COCIM Eukaryotic translation initiation factor 3 subunit H OS=Coccidioides immitis (strain RS) GN=CIMG_10297 PE=3 SV=2 4 359 2.0E-161
sp|A1CQB4|EIF3H_ASPCL Eukaryotic translation initiation factor 3 subunit H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_025520 PE=3 SV=1 4 359 6.0E-160
sp|Q2U2J1|EIF3H_ASPOR Eukaryotic translation initiation factor 3 subunit H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090038000435 PE=3 SV=1 4 359 1.0E-158
sp|Q4WTA6|EIF3H_ASPFU Eukaryotic translation initiation factor 3 subunit H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G09970 PE=3 SV=1 4 359 9.0E-158
sp|B0XQB9|EIF3H_ASPFC Eukaryotic translation initiation factor 3 subunit H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_009410 PE=3 SV=1 4 359 9.0E-158
sp|Q0D1J4|EIF3H_ASPTN Eukaryotic translation initiation factor 3 subunit H OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_00190 PE=3 SV=1 4 359 9.0E-157
sp|A2QQA2|EIF3H_ASPNC Eukaryotic translation initiation factor 3 subunit H OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An08g01790 PE=3 SV=1 4 359 3.0E-155
sp|Q5BDW0|EIF3H_EMENI Eukaryotic translation initiation factor 3 subunit H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1270 PE=3 SV=2 9 359 4.0E-155
sp|A1D379|EIF3H_NEOFI Eukaryotic translation initiation factor 3 subunit H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_015650 PE=3 SV=1 21 359 2.0E-150
sp|Q6C1I3|EIF3H_YARLI Eukaryotic translation initiation factor 3 subunit H OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F16005g PE=3 SV=1 13 358 5.0E-83
sp|Q9UT48|EIF3H_SCHPO Eukaryotic translation initiation factor 3 subunit H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eif3h PE=1 SV=1 5 354 5.0E-74
sp|Q9C5Z2|EIF3H_ARATH Eukaryotic translation initiation factor 3 subunit H OS=Arabidopsis thaliana GN=TIF3H1 PE=1 SV=2 2 354 5.0E-65
sp|Q4PI64|EIF3H_USTMA Eukaryotic translation initiation factor 3 subunit H OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_00199 PE=3 SV=1 10 339 4.0E-63
sp|Q9GV27|EIF3H_BOMMO Eukaryotic translation initiation factor 3 subunit H OS=Bombyx mori PE=2 SV=1 7 351 5.0E-58
sp|B5RI54|EIF3H_SALSA Eukaryotic translation initiation factor 3 subunit H OS=Salmo salar GN=eif3h PE=2 SV=1 4 351 3.0E-57
sp|A7SA47|EIF3H_NEMVE Eukaryotic translation initiation factor 3 subunit H OS=Nematostella vectensis GN=v1g168210 PE=3 SV=1 13 351 1.0E-56
sp|B0WDA9|EIF3H_CULQU Eukaryotic translation initiation factor 3 subunit H OS=Culex quinquefasciatus GN=CPIJ005299 PE=3 SV=1 7 351 1.0E-55
sp|Q5PPY6|EIF3H_XENLA Eukaryotic translation initiation factor 3 subunit H OS=Xenopus laevis GN=eif3h PE=2 SV=1 5 351 1.0E-55
sp|Q170C2|EIF3H_AEDAE Eukaryotic translation initiation factor 3 subunit H OS=Aedes aegypti GN=AAEL007945 PE=2 SV=1 7 351 8.0E-55
sp|Q6AXJ2|EI3HA_DANRE Eukaryotic translation initiation factor 3 subunit H-A OS=Danio rerio GN=eif3ha PE=2 SV=1 7 351 6.0E-54
sp|Q5PR67|EI3HB_DANRE Eukaryotic translation initiation factor 3 subunit H-B OS=Danio rerio GN=eif3hb PE=2 SV=2 2 351 5.0E-53
sp|O15372|EIF3H_HUMAN Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens GN=EIF3H PE=1 SV=1 7 351 5.0E-53
sp|Q6P381|EIF3H_XENTR Eukaryotic translation initiation factor 3 subunit H OS=Xenopus tropicalis GN=eif3h PE=2 SV=1 4 351 8.0E-53
sp|Q56JZ5|EIF3H_BOVIN Eukaryotic translation initiation factor 3 subunit H OS=Bos taurus GN=EIF3H PE=2 SV=1 7 351 1.0E-52
sp|Q91WK2|EIF3H_MOUSE Eukaryotic translation initiation factor 3 subunit H OS=Mus musculus GN=Eif3h PE=1 SV=1 7 351 3.0E-52
sp|Q6P9U8|EIF3H_RAT Eukaryotic translation initiation factor 3 subunit H OS=Rattus norvegicus GN=Eif3h PE=1 SV=1 7 351 7.0E-52
sp|Q54UD0|EIF3H_DICDI Eukaryotic translation initiation factor 3 subunit H OS=Dictyostelium discoideum GN=eif3H PE=3 SV=1 7 355 1.0E-51
sp|B5FY35|EIF3H_TAEGU Eukaryotic translation initiation factor 3 subunit H OS=Taeniopygia guttata GN=EIF3H PE=2 SV=1 7 351 3.0E-51
sp|Q7PVR3|EIF3H_ANOGA Eukaryotic translation initiation factor 3 subunit H OS=Anopheles gambiae GN=AGAP009204 PE=3 SV=3 7 351 3.0E-51
sp|Q5ZLE6|EIF3H_CHICK Eukaryotic translation initiation factor 3 subunit H OS=Gallus gallus GN=EIF3H PE=2 SV=1 7 351 3.0E-50
sp|B4I1C2|EIF3H_DROSE Eukaryotic translation initiation factor 3 subunit H OS=Drosophila sechellia GN=eIF-3p40 PE=3 SV=1 7 351 1.0E-48
sp|Q9U9Q4|EIF3H_DROME Eukaryotic translation initiation factor 3 subunit H OS=Drosophila melanogaster GN=eIF-3p40 PE=2 SV=2 7 351 5.0E-48
sp|B3N4F1|EIF3H_DROER Eukaryotic translation initiation factor 3 subunit H OS=Drosophila erecta GN=eIF-3p40 PE=3 SV=1 7 351 4.0E-47
sp|B3MP94|EIF3H_DROAN Eukaryotic translation initiation factor 3 subunit H OS=Drosophila ananassae GN=eIF-3p40 PE=3 SV=1 7 351 7.0E-47
sp|B4LTW0|EIF3H_DROVI Eukaryotic translation initiation factor 3 subunit H OS=Drosophila virilis GN=eIF-3p40 PE=3 SV=1 7 351 7.0E-47
sp|B4KGS4|EIF3H_DROMO Eukaryotic translation initiation factor 3 subunit H OS=Drosophila mojavensis GN=eIF-3p40 PE=3 SV=1 13 351 2.0E-46
sp|B4JAS7|EIF3H_DROGR Eukaryotic translation initiation factor 3 subunit H OS=Drosophila grimshawi GN=eIF-3p40 PE=3 SV=1 13 351 5.0E-46
sp|B5DJJ2|EIF3H_DROPS Eukaryotic translation initiation factor 3 subunit H OS=Drosophila pseudoobscura pseudoobscura GN=eIF-3p40 PE=3 SV=1 7 351 6.0E-46
sp|B4P3T9|EIF3H_DROYA Eukaryotic translation initiation factor 3 subunit H OS=Drosophila yakuba GN=eIF-3p40 PE=3 SV=1 7 351 7.0E-46
sp|B4N116|EIF3H_DROWI Eukaryotic translation initiation factor 3 subunit H OS=Drosophila willistoni GN=eIF-3p40 PE=3 SV=1 13 351 3.0E-45
sp|A9V3P1|EIF3H_MONBE Eukaryotic translation initiation factor 3 subunit H OS=Monosiga brevicollis GN=9558 PE=3 SV=1 13 354 3.0E-38
sp|A8QCY3|EIF3H_BRUMA Eukaryotic translation initiation factor 3 subunit H OS=Brugia malayi GN=Bm1_50170 PE=3 SV=1 11 329 4.0E-26
sp|O01974|EIF3H_CAEEL Eukaryotic translation initiation factor 3 subunit H OS=Caenorhabditis elegans GN=eif-3.H PE=3 SV=2 13 328 9.0E-24
sp|A8WVY9|EIF3H_CAEBR Eukaryotic translation initiation factor 3 subunit H OS=Caenorhabditis briggsae GN=eif-3.H PE=3 SV=3 13 328 1.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1432
MNEAVKDAPFQAVQVEALVAMKIAKHCSLTFPTTATGAVVGMDQKGLLEVTNSFPFPSAEGAVVDNHPNDPSAIA
AAAPRQKSNAAYQVDMIRNLKEVNVDANSVGWYTSATMGNFVNMSFIENQFFYQKDNERTIALVYDTSKSSQGSL
TLRAFRLTTTFMNAYKEGKFTTESLQKSKLSFRDIIAELPIVIHNSHLLTSFLHQMPAPPLQDEIEQPESLADLK
RSAIRPPLYPSIENLDLSIDPFLEKTCDLLLESIESHYTDLNNFQFYQRQLGREQAKINQWQAKRKAENAQRAVA
KQPLLPEDEWQRLFKLPQEPSRLEGMLNAKQVEQYGKQVDGFTANISAKMFAVREDLLPQ*
Coding >OphauG2|1432
ATGAACGAAGCTGTCAAAGATGCGCCCTTCCAGGCGGTCCAGGTTGAGGCGCTGGTTGCAATGAAAATTGCAAAA
CATTGCTCCCTGACTTTTCCGACGACAGCCACGGGCGCTGTGGTCGGAATGGACCAAAAGGGCCTTTTGGAAGTC
ACCAATTCCTTTCCATTTCCCTCGGCCGAAGGTGCCGTTGTCGACAACCATCCAAACGATCCCTCGGCGATTGCA
GCAGCCGCTCCCCGGCAAAAATCCAATGCAGCGTACCAGGTGGACATGATTCGAAATCTCAAAGAGGTCAATGTG
GACGCCAACAGCGTCGGCTGGTACACCAGTGCCACCATGGGGAACTTTGTCAACATGAGCTTCATCGAGAACCAA
TTCTTCTACCAGAAAGACAATGAGCGCACCATTGCTCTCGTTTACGACACGAGCAAGAGCTCTCAGGGAAGCCTG
ACCCTCAGGGCGTTTCGCCTGACGACAACCTTTATGAACGCCTACAAGGAGGGCAAGTTTACCACGGAGAGCCTT
CAAAAGTCCAAGCTCTCTTTCCGCGACATAATCGCCGAGCTACCCATTGTGATACACAACTCGCATCTTCTCACC
TCGTTCCTCCACCAAATGCCTGCTCCTCCATTGCAGGACGAAATTGAGCAACCCGAGTCACTAGCCGACCTAAAG
CGCAGCGCCATCAGGCCCCCACTGTACCCCTCCATCGAGAACCTCGATCTATCTATCGATCCTTTTCTTGAAAAG
ACGTGCGATCTTTTACTTGAAAGCATCGAGTCGCATTACACAGACCTCAACAACTTTCAGTTTTACCAAAGGCAG
CTCGGGCGTGAGCAGGCCAAGATTAATCAGTGGCAAGCCAAGCGCAAGGCCGAAAACGCGCAGCGTGCTGTGGCC
AAGCAACCGCTGCTCCCCGAAGACGAGTGGCAGCGACTCTTCAAGCTACCGCAAGAACCCAGTCGCCTCGAGGGA
ATGCTCAATGCCAAGCAGGTGGAGCAGTATGGCAAGCAGGTTGATGGCTTCACCGCAAATATTAGTGCCAAGATG
TTTGCCGTAAGAGAAGATTTATTGCCTCAGTAG
Transcript >OphauG2|1432
ATGAACGAAGCTGTCAAAGATGCGCCCTTCCAGGCGGTCCAGGTTGAGGCGCTGGTTGCAATGAAAATTGCAAAA
CATTGCTCCCTGACTTTTCCGACGACAGCCACGGGCGCTGTGGTCGGAATGGACCAAAAGGGCCTTTTGGAAGTC
ACCAATTCCTTTCCATTTCCCTCGGCCGAAGGTGCCGTTGTCGACAACCATCCAAACGATCCCTCGGCGATTGCA
GCAGCCGCTCCCCGGCAAAAATCCAATGCAGCGTACCAGGTGGACATGATTCGAAATCTCAAAGAGGTCAATGTG
GACGCCAACAGCGTCGGCTGGTACACCAGTGCCACCATGGGGAACTTTGTCAACATGAGCTTCATCGAGAACCAA
TTCTTCTACCAGAAAGACAATGAGCGCACCATTGCTCTCGTTTACGACACGAGCAAGAGCTCTCAGGGAAGCCTG
ACCCTCAGGGCGTTTCGCCTGACGACAACCTTTATGAACGCCTACAAGGAGGGCAAGTTTACCACGGAGAGCCTT
CAAAAGTCCAAGCTCTCTTTCCGCGACATAATCGCCGAGCTACCCATTGTGATACACAACTCGCATCTTCTCACC
TCGTTCCTCCACCAAATGCCTGCTCCTCCATTGCAGGACGAAATTGAGCAACCCGAGTCACTAGCCGACCTAAAG
CGCAGCGCCATCAGGCCCCCACTGTACCCCTCCATCGAGAACCTCGATCTATCTATCGATCCTTTTCTTGAAAAG
ACGTGCGATCTTTTACTTGAAAGCATCGAGTCGCATTACACAGACCTCAACAACTTTCAGTTTTACCAAAGGCAG
CTCGGGCGTGAGCAGGCCAAGATTAATCAGTGGCAAGCCAAGCGCAAGGCCGAAAACGCGCAGCGTGCTGTGGCC
AAGCAACCGCTGCTCCCCGAAGACGAGTGGCAGCGACTCTTCAAGCTACCGCAAGAACCCAGTCGCCTCGAGGGA
ATGCTCAATGCCAAGCAGGTGGAGCAGTATGGCAAGCAGGTTGATGGCTTCACCGCAAATATTAGTGCCAAGATG
TTTGCCGTAAGAGAAGATTTATTGCCTCAGTAG
Gene >OphauG2|1432
ATGAACGAAGCTGTCAAAGATGCGCCCTTCCAGGCGGTCCAGGTTGAGGCGCTGGTGAGTCTCCAATCAGCCCCA
CCTTGGCCTTGTGGCCTCATTGCTGCGACTGACAAACAACTGTCGTGGACAGGTTGCAATGAAAATTGCAAAACA
TTGCTCCCTGACTTTTCCGACGACAGCCACGGGCGCTGTGGTCGGAATGGACCAAAAGGGCCTTTTGGAAGTCAC
CAATTCCTTTCCATTTCCCTCGGCCGAAGGTGCCGTTGTCGACAACCATCCAAACGATCCCTCGGCGATTGCAGC
AGCCGCTCCCCGGCAAAAATCCAATGCAGCGTACCAGGTGGACATGATTCGAAATCTCAAAGAGGTCAATGTGGA
CGCCAACAGCGTCGGCTGGTACACCAGTGCCACCATGGGGAACTTTGTCAACATGAGCTTCATCGAGAACCAATT
CTTCTACCAGAAAGACAATGAGCGCACCATTGCTCTCGTTTACGACACGAGCAAGAGCTCTCAGGGAAGCCTGAC
CCTCAGGGCGTTTCGCCTGACGACAACCTTTATGAACGCCTACAAGGAGGGCAAGTTTACCACGGAGAGGTGAGT
TTAGATATAAAACTTGGAACAAAGCAGGCCTGGACTCATACCGTTCCAGCCTTCAAAAGTCCAAGCTCTCTTTCC
GCGACATAATCGCCGAGCTACCCATTGTGATACACAACTCGCATCTTCTCACCTCGTTCCTCCACCAAATGCCTG
CTCCTCCATTGCAGGACGAAATTGAGCAACCCGAGTCACTAGCCGACCTAAAGCGCAGCGCCATCAGGCCCCCAC
TGTACCCCTCCATCGAGAACCTCGATCTATCTATCGATCCTTTTCTTGAAAAGACGTGCGATCTTTTACTTGAAA
GCATCGAGTCGCATTACACAGACCTCAACAACTTTCAGTTTTACCAAAGGCAGCTCGGGCGTGAGCAGGCCAAGA
TTAATCAGTGGCAAGCCAAGCGCAAGGCCGAAAACGCGCAGCGTGCTGTGGCCAAGCAACCGCTGCTCCCCGAAG
ACGAGTGGCAGCGACTCTTCAAGCTACCGCAAGAACCCAGTCGCCTCGAGGGAATGCTCAATGCCAAGCAGGTGG
AGCAGTATGGCAAGCAGGTTGATGGCTTCACCGCAAATATTAGTGCCAAGATGTTTGCCGTAAGAGAAGATTTAT
TGCCTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail