Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1424
Gene name
LocationContig_1425:2712..3235
Strand-
Gene length (bp)523
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10262 Rdx Rdx family 4.9E-17 30 126

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3839
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1424 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4088
Ophiocordyceps camponoti-floridani Ophcf2|04492
Ophiocordyceps camponoti-rufipedis Ophun1|7400
Ophiocordyceps kimflemingae Ophio5|1601
Ophiocordyceps subramaniannii Hirsu2|7555

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1424
MTPLCQQTSCQHMDIRQKAQQKKPTKKKKTTQKKYAQELLSTFPSLGEVALQPGSSGTFIISLTTSCDGASHDST
PPAPASTPPETTSPTLNPPRPPQTCTTTVLWDRRRDSGFPETKLLKRLVRDVVDPSRALGHIDGLPSVPRPAPAC
EDC*
Coding >OphauG2|1424
ATGACTCCTCTCTGCCAGCAGACCTCATGTCAGCACATGGACATTCGGCAAAAGGCCCAGCAGAAGAAACCAACC
AAAAAAAAAAAAACCACCCAAAAAAAGTACGCGCAAGAACTCCTCTCCACCTTTCCCTCCCTCGGCGAGGTGGCT
CTACAGCCTGGCAGCAGCGGCACATTCATCATCTCCCTGACTACCAGCTGCGACGGAGCCTCGCACGACTCGACG
CCGCCCGCCCCCGCCTCGACTCCTCCCGAGACCACGTCGCCGACTTTGAATCCGCCACGGCCTCCCCAAACTTGT
ACAACTACTGTTCTGTGGGACCGCCGTCGCGACTCGGGCTTTCCGGAAACAAAGCTTCTCAAACGCCTTGTTCGA
GATGTCGTTGATCCAAGCCGCGCCCTCGGCCATATTGACGGCCTGCCCAGCGTGCCTCGTCCCGCTCCCGCCTGT
GAGGACTGCTAG
Transcript >OphauG2|1424
ATGACTCCTCTCTGCCAGCAGACCTCATGTCAGCACATGGACATTCGGCAAAAGGCCCAGCAGAAGAAACCAACC
AAAAAAAAAAAAACCACCCAAAAAAAGTACGCGCAAGAACTCCTCTCCACCTTTCCCTCCCTCGGCGAGGTGGCT
CTACAGCCTGGCAGCAGCGGCACATTCATCATCTCCCTGACTACCAGCTGCGACGGAGCCTCGCACGACTCGACG
CCGCCCGCCCCCGCCTCGACTCCTCCCGAGACCACGTCGCCGACTTTGAATCCGCCACGGCCTCCCCAAACTTGT
ACAACTACTGTTCTGTGGGACCGCCGTCGCGACTCGGGCTTTCCGGAAACAAAGCTTCTCAAACGCCTTGTTCGA
GATGTCGTTGATCCAAGCCGCGCCCTCGGCCATATTGACGGCCTGCCCAGCGTGCCTCGTCCCGCTCCCGCCTGT
GAGGACTGCTAG
Gene >OphauG2|1424
ATGACTCCTCTCTGCCAGCAGACCTCATGTCAGCACATGGACATGTGCCACACGGTTAACCATGCATCCATACGA
GTAATAAGATGGGCTGACTGATTATTCTAGTCGGCAAAAGGCCCAGCAGAAGAAACCAACCAAAAAAAAAAAAAC
CACCCAAAAAAAGTACGCGCAAGAACTCCTCTCCACCTTTCCCTCCCTCGGCGAGGTGGCTCTACAGCCTGGCAG
CAGCGGCACATTCATCATCTCCCTGACTACCAGCTGCGACGGAGCCTCGCACGACTCGACGCCGCCCGCCCCCGC
CTCGACTCCTCCCGAGACCACGTCGCCGACTTTGAATCCGCCACGGCCTCCCCAAACTTGTACAACTACTGTTCT
GTGGGACCGCCGTCGCGACTCGGGCTTTCCGGAAACAAAGCTTCTCAAACGCCTTGTTCGAGATGTCGTTGATCC
AAGCCGCGCCCTCGGCCATATTGACGGCCTGCCCAGCGTGCCTCGTCCCGCTCCCGCCTGTGAGGACTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail