Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|142
Gene name
LocationContig_102:4182..6952
Strand+
Gene length (bp)2770
Transcript length (bp)2583
Coding sequence length (bp)2583
Protein length (aa) 861

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12738 PTCB-BRCT twin BRCT domain 4.6E-19 347 409
PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain 5.6E-25 615 713
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 5.5E-06 9 90
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 8.1E-09 344 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 58 431 1.0E-41
sp|P38850|RT107_YEAST Regulator of Ty1 transposition protein 107 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT107 PE=1 SV=1 57 450 2.0E-25
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 535 851 3.0E-20
sp|Q14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens GN=MDC1 PE=1 SV=3 666 753 2.0E-08
sp|Q7YR40|MDC1_PANTR Mediator of DNA damage checkpoint protein 1 OS=Pan troglodytes GN=MDC1 PE=3 SV=1 668 753 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 58 431 1.0E-41
sp|P38850|RT107_YEAST Regulator of Ty1 transposition protein 107 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT107 PE=1 SV=1 57 450 2.0E-25
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 535 851 3.0E-20
sp|Q14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens GN=MDC1 PE=1 SV=3 666 753 2.0E-08
sp|Q7YR40|MDC1_PANTR Mediator of DNA damage checkpoint protein 1 OS=Pan troglodytes GN=MDC1 PE=3 SV=1 668 753 3.0E-08
sp|Q5TM68|MDC1_MACMU Mediator of DNA damage checkpoint protein 1 OS=Macaca mulatta GN=MDC1 PE=3 SV=1 668 753 3.0E-08
sp|Q767L8|MDC1_PIG Mediator of DNA damage checkpoint protein 1 OS=Sus scrofa GN=MDC1 PE=3 SV=1 668 753 3.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3813
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|142 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|495
Ophiocordyceps camponoti-floridani Ophcf2|01226
Ophiocordyceps camponoti-rufipedis Ophun1|1551
Ophiocordyceps kimflemingae Ophio5|7790
Ophiocordyceps subramaniannii Hirsu2|7464

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|142
MADELGISGVFSECVVAFVPSSTLAPKHISELAKVVEDNGATICEPRRDGTIAMGKVTHIVSNTIDFGQYVESQA
VMIPVVSTQWITASISRRRQAQVRPFSPDPRMIFAEVVVTCGDVPVMDKEGILGATMALGGQESKDVNRLTTHVC
SLSMDHPKVQMALKMMDQKGWKGKIVLPHWFDACFKLGKRIDEGPYLLPNPKVFSLGPADELEIPKTPCLEGATS
ANPQWLPVPPDIKSGRPPVTVFRDRKVFLSSDLGITSRLVKVLADLINNGGGKWVDDVDDCDMFICQYRDGAQYV
KAAQSCKEIGSLSWLFYLVVHNQWRNPLHRLLHYPVPRKGIEGFENLRITVSNYGGEARTYLENLIRACGAEYTK
TMRPENTHLVTARDTSDKCKAAPEWGVAVINHLWLEESYAKCEKKQINISKYNHFPPCTNLGEIIGQTFLDESCL
REMYYPGGEDSMSPRAKRKRKILEAAEDNAYHQGPAEGVVIGRSRQQQSANVSQAESNARSVEMANAKIASVRTP
RRPQPGKENSSPSLLSVGSRSAKAKAKDLLQTIAPDIALYEKEKKRHTKAGVPWGGKRAADNAEKQTKAKAAAAK
ALQEAENEAAATPVRPAKKARPSLPEIELRIAITSYDKWTDDSNQEDRDRLRLRNLGIQVVQHPPCDYVVAPRIV
RTVKFLCSLAWGASVLSVDFIDEVLKKGEIPIPEEYALNDQEGESRNNFRIVKSVARAKAHKGKLLQGIPIYCTE
KIKGGWESYQSISQANGAIFKVYRARSGTTIKPSTVDEDGDTPPDPVYLLTHNSSEEKQLWPRFKEMAKRGNMEP
RVVAGDWLLDVCMAQEVRFSEKFLAETWYASEGGK*
Coding >OphauG2|142
ATGGCAGACGAACTTGGCATCAGCGGTGTTTTCAGTGAGTGCGTGGTTGCCTTTGTGCCGAGCAGCACGCTGGCA
CCTAAACACATCAGCGAGTTAGCCAAAGTGGTCGAAGATAATGGAGCGACGATTTGCGAGCCTCGACGCGACGGA
ACGATAGCCATGGGCAAGGTGACGCACATCGTTTCCAATACAATCGACTTTGGGCAATACGTTGAGTCTCAGGCC
GTCATGATACCTGTCGTGTCGACGCAATGGATCACTGCTTCGATATCACGGCGGCGGCAGGCCCAAGTGCGACCA
TTTTCGCCCGACCCACGCATGATTTTCGCCGAAGTGGTGGTGACGTGTGGTGACGTGCCCGTCATGGACAAGGAG
GGAATTCTCGGTGCAACCATGGCATTAGGTGGACAAGAGTCAAAGGACGTCAATCGGCTAACGACGCACGTGTGT
TCCTTGTCCATGGACCACCCAAAGGTGCAGATGGCTTTGAAAATGATGGATCAAAAGGGCTGGAAGGGCAAGATT
GTCTTGCCACACTGGTTCGATGCTTGCTTCAAGCTCGGCAAACGAATTGATGAAGGCCCGTACCTTCTTCCAAAC
CCCAAAGTATTCAGTCTCGGCCCTGCCGATGAACTCGAGATTCCTAAAACCCCCTGTCTCGAGGGTGCCACTTCA
GCCAACCCACAGTGGCTACCGGTGCCCCCAGATATCAAGTCCGGCCGCCCCCCTGTCACCGTGTTTCGTGATCGA
AAAGTCTTCTTGTCCTCTGATCTGGGCATTACGTCCCGTCTTGTCAAGGTATTGGCTGACTTGATTAACAATGGC
GGCGGGAAATGGGTCGACGACGTCGACGACTGCGACATGTTCATCTGCCAGTACCGCGACGGGGCTCAGTATGTT
AAGGCTGCCCAATCGTGCAAAGAAATCGGTAGCCTCTCGTGGCTTTTTTACCTCGTTGTACACAACCAGTGGCGC
AACCCTCTGCACCGCTTGTTGCACTATCCAGTGCCTAGGAAAGGAATTGAAGGCTTCGAAAATCTGCGCATAACC
GTCTCCAACTACGGCGGCGAGGCGCGCACCTACCTCGAGAACCTCATCAGAGCCTGTGGCGCCGAATACACCAAG
ACAATGAGACCGGAAAACACGCACCTCGTGACGGCCCGCGATACGAGTGACAAGTGCAAGGCGGCTCCCGAATGG
GGCGTCGCCGTCATCAACCACCTCTGGCTCGAAGAAAGCTATGCCAAGTGTGAGAAGAAGCAGATCAATATTTCA
AAGTATAACCATTTTCCCCCATGCACCAACCTTGGCGAAATTATTGGTCAAACTTTTCTGGACGAATCGTGTCTG
CGAGAAATGTATTATCCTGGAGGCGAAGATTCCATGTCTCCCAGGGCAAAGAGGAAACGCAAGATTCTCGAGGCC
GCCGAAGACAATGCGTACCATCAAGGGCCTGCCGAGGGTGTCGTTATAGGACGATCGCGCCAGCAACAAAGTGCA
AATGTCTCTCAGGCCGAGTCCAATGCCAGAAGCGTCGAGATGGCAAATGCCAAGATAGCTTCGGTGCGGACACCC
AGACGGCCCCAGCCGGGCAAGGAAAACAGTAGCCCGTCATTACTGTCAGTCGGTAGTCGCAGTGCCAAGGCCAAA
GCCAAAGACCTACTACAGACGATTGCGCCCGATATCGCCCTGTACGAAAAGGAAAAGAAGAGACATACCAAGGCG
GGTGTTCCTTGGGGAGGGAAACGGGCTGCGGATAACGCCGAGAAGCAGACCAAGGCCAAGGCGGCGGCAGCCAAG
GCTTTACAAGAGGCGGAAAATGAAGCTGCCGCAACACCCGTGAGACCTGCCAAAAAGGCACGACCATCGCTCCCT
GAAATTGAACTGCGCATTGCCATTACCTCATACGACAAATGGACAGACGACAGTAATCAGGAGGATCGCGATAGG
TTACGGTTACGCAATCTAGGTATACAGGTCGTGCAGCACCCTCCGTGTGACTATGTTGTTGCGCCGCGCATCGTG
CGCACCGTCAAGTTTCTTTGCTCTCTAGCATGGGGTGCGAGCGTTCTTTCCGTCGATTTCATTGACGAGGTGCTC
AAAAAAGGCGAGATTCCAATTCCAGAAGAATACGCCTTGAATGATCAAGAAGGTGAATCAAGGAACAACTTTCGC
ATTGTCAAGTCAGTGGCGAGGGCCAAGGCCCACAAGGGAAAACTGTTGCAGGGAATTCCGATATACTGCACTGAG
AAAATCAAGGGGGGGTGGGAGAGTTACCAATCCATTTCCCAGGCCAATGGCGCCATTTTCAAAGTGTACCGGGCG
CGCAGTGGAACGACTATCAAGCCCTCAACGGTCGACGAAGACGGCGACACGCCGCCAGACCCCGTCTATCTGTTG
ACGCATAACAGCTCCGAAGAGAAACAGCTGTGGCCGCGGTTCAAGGAAATGGCCAAGAGGGGTAACATGGAGCCG
CGTGTAGTGGCGGGCGACTGGCTTTTGGATGTGTGCATGGCACAAGAGGTGCGGTTCAGTGAAAAGTTTTTGGCG
GAGACATGGTACGCGTCTGAGGGTGGTAAGTGA
Transcript >OphauG2|142
ATGGCAGACGAACTTGGCATCAGCGGTGTTTTCAGTGAGTGCGTGGTTGCCTTTGTGCCGAGCAGCACGCTGGCA
CCTAAACACATCAGCGAGTTAGCCAAAGTGGTCGAAGATAATGGAGCGACGATTTGCGAGCCTCGACGCGACGGA
ACGATAGCCATGGGCAAGGTGACGCACATCGTTTCCAATACAATCGACTTTGGGCAATACGTTGAGTCTCAGGCC
GTCATGATACCTGTCGTGTCGACGCAATGGATCACTGCTTCGATATCACGGCGGCGGCAGGCCCAAGTGCGACCA
TTTTCGCCCGACCCACGCATGATTTTCGCCGAAGTGGTGGTGACGTGTGGTGACGTGCCCGTCATGGACAAGGAG
GGAATTCTCGGTGCAACCATGGCATTAGGTGGACAAGAGTCAAAGGACGTCAATCGGCTAACGACGCACGTGTGT
TCCTTGTCCATGGACCACCCAAAGGTGCAGATGGCTTTGAAAATGATGGATCAAAAGGGCTGGAAGGGCAAGATT
GTCTTGCCACACTGGTTCGATGCTTGCTTCAAGCTCGGCAAACGAATTGATGAAGGCCCGTACCTTCTTCCAAAC
CCCAAAGTATTCAGTCTCGGCCCTGCCGATGAACTCGAGATTCCTAAAACCCCCTGTCTCGAGGGTGCCACTTCA
GCCAACCCACAGTGGCTACCGGTGCCCCCAGATATCAAGTCCGGCCGCCCCCCTGTCACCGTGTTTCGTGATCGA
AAAGTCTTCTTGTCCTCTGATCTGGGCATTACGTCCCGTCTTGTCAAGGTATTGGCTGACTTGATTAACAATGGC
GGCGGGAAATGGGTCGACGACGTCGACGACTGCGACATGTTCATCTGCCAGTACCGCGACGGGGCTCAGTATGTT
AAGGCTGCCCAATCGTGCAAAGAAATCGGTAGCCTCTCGTGGCTTTTTTACCTCGTTGTACACAACCAGTGGCGC
AACCCTCTGCACCGCTTGTTGCACTATCCAGTGCCTAGGAAAGGAATTGAAGGCTTCGAAAATCTGCGCATAACC
GTCTCCAACTACGGCGGCGAGGCGCGCACCTACCTCGAGAACCTCATCAGAGCCTGTGGCGCCGAATACACCAAG
ACAATGAGACCGGAAAACACGCACCTCGTGACGGCCCGCGATACGAGTGACAAGTGCAAGGCGGCTCCCGAATGG
GGCGTCGCCGTCATCAACCACCTCTGGCTCGAAGAAAGCTATGCCAAGTGTGAGAAGAAGCAGATCAATATTTCA
AAGTATAACCATTTTCCCCCATGCACCAACCTTGGCGAAATTATTGGTCAAACTTTTCTGGACGAATCGTGTCTG
CGAGAAATGTATTATCCTGGAGGCGAAGATTCCATGTCTCCCAGGGCAAAGAGGAAACGCAAGATTCTCGAGGCC
GCCGAAGACAATGCGTACCATCAAGGGCCTGCCGAGGGTGTCGTTATAGGACGATCGCGCCAGCAACAAAGTGCA
AATGTCTCTCAGGCCGAGTCCAATGCCAGAAGCGTCGAGATGGCAAATGCCAAGATAGCTTCGGTGCGGACACCC
AGACGGCCCCAGCCGGGCAAGGAAAACAGTAGCCCGTCATTACTGTCAGTCGGTAGTCGCAGTGCCAAGGCCAAA
GCCAAAGACCTACTACAGACGATTGCGCCCGATATCGCCCTGTACGAAAAGGAAAAGAAGAGACATACCAAGGCG
GGTGTTCCTTGGGGAGGGAAACGGGCTGCGGATAACGCCGAGAAGCAGACCAAGGCCAAGGCGGCGGCAGCCAAG
GCTTTACAAGAGGCGGAAAATGAAGCTGCCGCAACACCCGTGAGACCTGCCAAAAAGGCACGACCATCGCTCCCT
GAAATTGAACTGCGCATTGCCATTACCTCATACGACAAATGGACAGACGACAGTAATCAGGAGGATCGCGATAGG
TTACGGTTACGCAATCTAGGTATACAGGTCGTGCAGCACCCTCCGTGTGACTATGTTGTTGCGCCGCGCATCGTG
CGCACCGTCAAGTTTCTTTGCTCTCTAGCATGGGGTGCGAGCGTTCTTTCCGTCGATTTCATTGACGAGGTGCTC
AAAAAAGGCGAGATTCCAATTCCAGAAGAATACGCCTTGAATGATCAAGAAGGTGAATCAAGGAACAACTTTCGC
ATTGTCAAGTCAGTGGCGAGGGCCAAGGCCCACAAGGGAAAACTGTTGCAGGGAATTCCGATATACTGCACTGAG
AAAATCAAGGGGGGGTGGGAGAGTTACCAATCCATTTCCCAGGCCAATGGCGCCATTTTCAAAGTGTACCGGGCG
CGCAGTGGAACGACTATCAAGCCCTCAACGGTCGACGAAGACGGCGACACGCCGCCAGACCCCGTCTATCTGTTG
ACGCATAACAGCTCCGAAGAGAAACAGCTGTGGCCGCGGTTCAAGGAAATGGCCAAGAGGGGTAACATGGAGCCG
CGTGTAGTGGCGGGCGACTGGCTTTTGGATGTGTGCATGGCACAAGAGGTGCGGTTCAGTGAAAAGTTTTTGGCG
GAGACATGGTACGCGTCTGAGGGTGGTAAGTGA
Gene >OphauG2|142
ATGGCAGACGAACTTGGCATCAGCGGTGTTTTCAGTGAGTGCGTGGTTGCCTTTGTGCCGAGCAGCACGCTGGCA
CCTAAACACATCAGCGAGGTTTGTTCACTCTGTATCATGGCCATTGGTAAGGCTAGTCGGCTGACCCAAGAATAC
AGTTAGCCAAAGTGGTCGAAGATAATGGAGCGACGATTTGCGAGCCTCGACGCGACGGAACGATAGCCATGGGCA
AGGTGACGCACATCGTTTCCAATACAATCGACTTTGGGCAATACGTTGAGTCTCAGGCCGTCATGATACCTGTCG
TGTCGACGCAATGGATCACTGCTTCGATATCACGGCGGCGGCAGGCCCAAGTGCGACCATTTTCGCCCGACCCAC
GCATGATTTTCGCCGAAGTGGTGGTGACGTGTGGTGACGTGCCCGTCATGGACAAGGAGGGAATTCTCGGTGCAA
CCATGGCATTAGGTGGACAAGAGTCAAAGGACGTCAATCGGCTAACGACGCACGTGTGTTCCTTGTCCATGGACC
ACCCAAAGGTGCAGATGGCTTTGAAAATGATGGATCAAAAGGGCTGGAAGGGCAAGATTGTCTTGCCACACTGGT
GAGCTCACTATTAATGGGGAAGGGGAGCAGCCGGCCGGAGCCATATGCTGATTTACTGTCACCAGGTTCGATGCT
TGCTTCAAGCTCGGCAAACGAATTGATGAAGGCCCGTACCTTCTTCCAAACCCCAAAGTATTCAGTCTCGGCCCT
GCCGATGAACTCGAGATTCCTAAAACCCCCTGTCTCGAGGGTGCCACTTCAGCCAACCCACAGTGGCTACCGGTG
CCCCCAGATATCAAGTCCGGCCGCCCCCCTGTCACCGTGTTTCGTGATCGAAAAGTCTTCTTGTCCTCTGATCTG
GGCATTACGTCCCGTCTTGTCAAGGTATTGGCTGACTTGATTAACAATGGCGGCGGGAAATGGGTCGACGACGTC
GACGACTGCGACATGTTCATCTGCCAGTACCGCGACGGGGCTCAGTATGTTAAGGCTGCCCAATCGTGCAAAGAA
ATCGGTAGCCTCTCGTGGCTTTTTTACCTCGTTGTACACAACCAGTGGCGCAACCCTCTGCACCGCTTGTTGCAC
TATCCAGTGCCTAGGAAAGGAATTGAAGGCTTCGAAAATCTGCGCATAACCGTCTCCAACTACGGCGGCGAGGCG
CGCACCTACCTCGAGAACCTCATCAGAGCCTGTGGCGCCGAATACACCAAGACAATGAGACCGGAAAACACGCAC
CTCGTGACGGCCCGCGATACGAGTGACAAGTGCAAGGCGGCTCCCGAATGGGGCGTCGCCGTCATCAACCACCTC
TGGCTCGAAGAAAGCTATGCCAAGTGTGAGAAGAAGCAGATCAATATTTCAAAGTATAACCATTTTCCCCCATGC
ACCAACCTTGGCGAAATTATTGGTCAAACTTTTCTGGACGAATCGTGTCTGCGAGAAATGTATTATCCTGGAGGC
GAAGATTCCATGTCTCCCAGGGCAAAGAGGAAACGCAAGATTCTCGAGGCCGCCGAAGACAATGCGTACCATCAA
GGGCCTGCCGAGGGTGTCGTTATAGGACGATCGCGCCAGCAACAAAGTGCAAATGTCTCTCAGGCCGAGTCCAAT
GCCAGAAGCGTCGAGATGGCAAATGCCAAGATAGCTTCGGTGCGGACACCCAGACGGCCCCAGCCGGGCAAGGAA
AACAGTAGCCCGTCATTACTGTCAGTCGGTAGTCGCAGTGCCAAGGCCAAAGCCAAAGACCTACTACAGACGATT
GCGCCCGATATCGCCCTGTACGAAAAGGAAAAGAAGAGACATACCAAGGCGGGTGTTCCTTGGGGAGGGAAACGG
GCTGCGGATAACGCCGAGAAGCAGACCAAGGCCAAGGCGGCGGCAGCCAAGGCTTTACAAGAGGCGGAAAATGAA
GCTGCCGCAACACCCGTGAGACCTGCCAAAAAGGCACGACCATCGCTCCCTGAAATTGAACTGCGCATTGCCATT
ACCTCATACGACAAATGGACAGACGACAGTAATCAGGAGGATCGCGATAGGGTGAGTCAAATTACATTTCGAGAC
TCGTGCTTGGTAGAGATTGCTCATTGCTGCTTTTTAGTTACGGTTACGCAATCTAGGTATACAGGTCGTGCAGCA
CCCTCCGTGTGACTATGTTGTTGCGCCGCGCATCGTGCGCACCGTCAAGTTTCTTTGCTCTCTAGCATGGGGTGC
GAGCGTTCTTTCCGTCGATTTCATTGACGAGGTGCTCAAAAAAGGCGAGATTCCAATTCCAGAAGAATACGCCTT
GAATGATCAAGAAGGTGAATCAAGGAACAACTTTCGCATTGTCAAGTCAGTGGCGAGGGCCAAGGCCCACAAGGG
AAAACTGTTGCAGGGAATTCCGATATACTGCACTGAGAAAATCAAGGGGGGGTGGGAGAGTTACCAATCCATTTC
CCAGGCCAATGGCGCCATTTTCAAAGTGTACCGGGCGCGCAGTGGAACGACTATCAAGCCCTCAACGGTCGACGA
AGACGGCGACACGCCGCCAGACCCCGTCTATCTGTTGACGCATAACAGCTCCGAAGAGAAACAGCTGTGGCCGCG
GTTCAAGGAAATGGCCAAGAGGGGTAACATGGAGCCGCGTGTAGTGGCGGGCGACTGGCTTTTGGATGTGTGCAT
GGCACAAGAGGTGCGGTTCAGTGAAAAGTTTTTGGCGGAGACATGGTACGCGTCTGAGGGTGGTAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail