Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1415
Gene name
LocationContig_142:28029..29445
Strand+
Gene length (bp)1416
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 2.8E-15 172 239
PF08544 GHMP_kinases_C GHMP kinases C terminal 6.4E-09 349 419

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P24521|ERG8_YEAST Phosphomevalonate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG8 PE=1 SV=2 17 417 3.0E-76
sp|Q9UT88|ERG8_SCHPO Probable phosphomevalonate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg8 PE=3 SV=1 16 425 2.0E-64
sp|Q97UL6|PMK_SULSO Phosphomevalonate kinase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2988 PE=1 SV=1 168 407 1.0E-11

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2087
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1415 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2722
Ophiocordyceps camponoti-floridani Ophcf2|04100
Ophiocordyceps camponoti-rufipedis Ophun1|3639
Ophiocordyceps kimflemingae Ophio5|3984
Ophiocordyceps subramaniannii Hirsu2|2439

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1415
MDLIVEAAMDESRPTVAVSAPGKVLLAGGYLVLDRKHSGLVLGLSARINVAAGAIHTSEGVQLNEIVVDSPQFVE
AQWRYGYHRAPEDGGIKVTQLQVGCRFSPNRFIETTLCYALTYIDCLAGRPSQHKITPARLVVLADNDYYSPASS
THPHAPSSSRFAHMGVRLADAHKTGLGSSAALVTALTAALLSHYLPTAAFDLSTPPGRRILHTLAQAAHCAAQAK
LGSGFDVAAAVYGSCLYRRFSPDLLAALADPGTAGFGASLASLVDSQSWDMDIQPLPPLPPGLSLRMCDVDCGSH
TVAMAKQLLAWRARDPPVSEPLWDKLQRANHHLAALLAQPSPSPDLSSAIAAIRHLLRTMAQLSGVPIEPPSQTQ
LLDALTTQVQGVYGGVVPGAGGYDALALLVRDDPDTASSIASFLSQWSKDTGTRVRLLSAIGQHHGARSESLDVY
AGWL*
Coding >OphauG2|1415
ATGGACTTGATTGTCGAGGCAGCCATGGATGAGTCGCGGCCCACGGTGGCCGTGTCGGCGCCGGGCAAAGTGCTG
CTGGCTGGCGGCTACCTGGTGCTGGACAGAAAGCACAGCGGGCTGGTGCTGGGCCTGAGCGCGCGCATCAACGTG
GCGGCGGGAGCCATCCATACCAGCGAGGGCGTGCAGCTCAACGAGATTGTCGTCGACAGTCCGCAGTTTGTCGAG
GCCCAGTGGCGCTACGGCTATCATCGCGCGCCCGAGGACGGAGGCATCAAGGTGACGCAGCTGCAAGTAGGATGC
AGATTCAGCCCCAACCGCTTCATCGAGACGACGCTCTGCTACGCCTTGACCTACATCGACTGCCTCGCCGGCCGC
CCGTCGCAGCACAAAATCACCCCCGCGCGCCTCGTGGTGCTGGCCGACAACGACTACTACTCGCCTGCCTCGTCG
ACGCACCCGCATGCGCCCTCGAGCAGCCGCTTCGCACACATGGGCGTGCGCCTGGCCGACGCCCACAAGACGGGC
CTCGGCTCCTCGGCCGCCCTCGTCACCGCCCTGACGGCCGCCCTGCTCAGCCATTACCTGCCCACGGCCGCCTTT
GACCTGTCCACCCCCCCCGGCCGCCGCATCCTGCACACCCTGGCCCAGGCTGCCCACTGTGCCGCCCAGGCCAAG
CTTGGCTCGGGCTTCGACGTTGCCGCTGCCGTCTACGGATCCTGTCTGTACCGCCGCTTCTCCCCCGACCTGCTG
GCCGCCCTTGCCGACCCCGGAACCGCCGGCTTTGGCGCCAGCCTGGCATCCCTCGTCGACTCGCAGTCGTGGGAC
ATGGACATCCAGCCCCTGCCTCCTCTGCCCCCAGGCCTGTCGCTGCGCATGTGCGATGTCGACTGCGGCAGCCAC
ACCGTCGCCATGGCCAAGCAGCTTCTGGCCTGGCGCGCCCGCGACCCCCCCGTCTCGGAGCCTCTGTGGGACAAG
CTCCAGCGCGCCAACCACCACCTTGCTGCTCTCCTCGCCCAGCCCAGCCCCAGCCCCGACCTCTCCTCGGCCATT
GCCGCCATTCGCCACCTGCTGCGAACCATGGCCCAGCTAAGCGGCGTGCCCATTGAGCCCCCGTCACAAACCCAG
CTGCTCGATGCTCTGACCACTCAAGTCCAGGGCGTCTATGGCGGAGTCGTGCCCGGTGCTGGCGGCTACGACGCC
CTAGCTCTACTTGTACGCGACGACCCCGACACCGCCTCGAGCATTGCCAGCTTTCTCTCGCAATGGAGCAAGGAT
ACGGGCACTCGCGTCCGCTTGCTGAGTGCCATTGGACAGCACCACGGTGCGCGATCCGAGAGCCTCGACGTCTAT
GCCGGTTGGCTGTAG
Transcript >OphauG2|1415
ATGGACTTGATTGTCGAGGCAGCCATGGATGAGTCGCGGCCCACGGTGGCCGTGTCGGCGCCGGGCAAAGTGCTG
CTGGCTGGCGGCTACCTGGTGCTGGACAGAAAGCACAGCGGGCTGGTGCTGGGCCTGAGCGCGCGCATCAACGTG
GCGGCGGGAGCCATCCATACCAGCGAGGGCGTGCAGCTCAACGAGATTGTCGTCGACAGTCCGCAGTTTGTCGAG
GCCCAGTGGCGCTACGGCTATCATCGCGCGCCCGAGGACGGAGGCATCAAGGTGACGCAGCTGCAAGTAGGATGC
AGATTCAGCCCCAACCGCTTCATCGAGACGACGCTCTGCTACGCCTTGACCTACATCGACTGCCTCGCCGGCCGC
CCGTCGCAGCACAAAATCACCCCCGCGCGCCTCGTGGTGCTGGCCGACAACGACTACTACTCGCCTGCCTCGTCG
ACGCACCCGCATGCGCCCTCGAGCAGCCGCTTCGCACACATGGGCGTGCGCCTGGCCGACGCCCACAAGACGGGC
CTCGGCTCCTCGGCCGCCCTCGTCACCGCCCTGACGGCCGCCCTGCTCAGCCATTACCTGCCCACGGCCGCCTTT
GACCTGTCCACCCCCCCCGGCCGCCGCATCCTGCACACCCTGGCCCAGGCTGCCCACTGTGCCGCCCAGGCCAAG
CTTGGCTCGGGCTTCGACGTTGCCGCTGCCGTCTACGGATCCTGTCTGTACCGCCGCTTCTCCCCCGACCTGCTG
GCCGCCCTTGCCGACCCCGGAACCGCCGGCTTTGGCGCCAGCCTGGCATCCCTCGTCGACTCGCAGTCGTGGGAC
ATGGACATCCAGCCCCTGCCTCCTCTGCCCCCAGGCCTGTCGCTGCGCATGTGCGATGTCGACTGCGGCAGCCAC
ACCGTCGCCATGGCCAAGCAGCTTCTGGCCTGGCGCGCCCGCGACCCCCCCGTCTCGGAGCCTCTGTGGGACAAG
CTCCAGCGCGCCAACCACCACCTTGCTGCTCTCCTCGCCCAGCCCAGCCCCAGCCCCGACCTCTCCTCGGCCATT
GCCGCCATTCGCCACCTGCTGCGAACCATGGCCCAGCTAAGCGGCGTGCCCATTGAGCCCCCGTCACAAACCCAG
CTGCTCGATGCTCTGACCACTCAAGTCCAGGGCGTCTATGGCGGAGTCGTGCCCGGTGCTGGCGGCTACGACGCC
CTAGCTCTACTTGTACGCGACGACCCCGACACCGCCTCGAGCATTGCCAGCTTTCTCTCGCAATGGAGCAAGGAT
ACGGGCACTCGCGTCCGCTTGCTGAGTGCCATTGGACAGCACCACGGTGCGCGATCCGAGAGCCTCGACGTCTAT
GCCGGTTGGCTGTAG
Gene >OphauG2|1415
ATGGACTTGATTGTCGAGGCAGCCATGGATGAGTCGCGGCCCACGGTGGCCGTGTCGGCGCCGGGCAAAGTGCTG
CTGGCTGGCGGCTACCTGGTGCTGGACAGAAAGCACAGCGGGCTGGTGCTGGGCCTGAGCGCGCGCATCAACGTG
GCGGCGGGAGCCATCCATACCAGCGAGGGCGTGCAGCTCAACGAGATTGTCGTCGACAGTCCGCAGTTTGTCGAG
GCCCAGTGGCGCTACGGCTATCATCGCGCGCCCGAGGACGGAGGCATCAAGGTGACGCAGCTGCAAGTGTTGGTC
TCCTCTCCCCTGCTCTCGCCTTGCCGCTGACCCGTCTGGTCTAGAGGATGCAGATTCAGCCCCAACCGCTTCATC
GAGACGACGCTCTGCTACGCCTTGACCTACATCGACTGCCTCGCCGGCCGCCCGTCGCAGCACAAAATCACCCCC
GCGCGCCTCGTGGTGCTGGCCGACAACGACTACTACTCGCCTGCCTCGTCGACGCACCCGCATGCGCCCTCGAGC
AGCCGCTTCGCACACATGGGCGTGCGCCTGGCCGACGCCCACAAGACGGGCCTCGGCTCCTCGGCCGCCCTCGTC
ACCGCCCTGACGGCCGCCCTGCTCAGCCATTACCTGCCCACGGCCGCCTTTGACCTGTCCACCCCCCCCGGCCGC
CGCATCCTGCACACCCTGGCCCAGGCTGCCCACTGTGCCGCCCAGGCCAAGCTTGGCTCGGGCTTCGACGTTGCC
GCTGCCGTCTACGGATCCTGTCTGTACCGCCGCTTCTCCCCCGACCTGCTGGCCGCCCTTGCCGACCCCGGAACC
GCCGGCTTTGGCGCCAGCCTGGCATCCCTCGTCGACTCGCAGTCGTGGGACATGGACATCCAGCCCCTGCCTCCT
CTGCCCCCAGGCCTGTCGCTGCGCATGTGCGATGTCGACTGCGGCAGCCACACCGTCGCCATGGCCAAGCAGCTT
CTGGCCTGGCGCGCCCGCGACCCCCCCGTCTCGGAGCCTCTGTGGGACAAGCTCCAGCGCGCCAACCACCACCTT
GCTGCTCTCCTCGCCCAGCCCAGCCCCAGCCCCGACCTCTCCTCGGCCATTGCCGCCATTCGCCACCTGCTGCGA
ACCATGGCCCAGCTAAGCGGCGTGCCCATTGAGCCCCCGTCACAAACCCAGCTGCTCGATGCTCTGACCACTCAA
GTCCAGGGCGTCTATGGCGGAGTCGTGCCCGGTGCTGGCGGCTACGACGCCCTAGCTCTACTTGTACGCGACGAC
CCCGACACCGCCTCGAGCATTGCCAGCTTTCTCTCGCAATGGAGCAAGGATACGGGCACTCGCGTCCGCTTGCTG
AGTGCCATTGGACAGCACCACGGTGCGCGATCCGAGAGCCTCGACGTCTATGCCGGTTGGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail