© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|1414 |
| Gene name | |
| Location | Contig_142:24079..27553 |
| Strand | + |
| Gene length (bp) | 3474 |
| Transcript length (bp) | 3474 |
| Coding sequence length (bp) | 3474 |
| Protein length (aa) | 1158 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF13041 | PPR_2 | PPR repeat family | 2.3E-08 | 854 | 903 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 9.5E-03 | 880 | 918 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 1.1E-03 | 930 | 973 |
| PF01535 | PPR | PPR repeat | 1.1E-03 | 373 | 399 |
| PF01535 | PPR | PPR repeat | 7.9E-01 | 411 | 431 |
| PF01535 | PPR | PPR repeat | 4.7E-03 | 858 | 887 |
| PF01535 | PPR | PPR repeat | 1.1E-03 | 892 | 918 |
| PF12854 | PPR_1 | PPR repeat | 1.4E-07 | 886 | 918 |
| PF17177 | PPR_long | Pentacotripeptide-repeat region of PRORP | 1.4E-06 | 826 | 970 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10451|PPR5_SCHPO | Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 | 735 | 1153 | 6.0E-72 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 721 | 1125 | 6.0E-26 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 718 | 1134 | 1.0E-24 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 718 | 1116 | 7.0E-24 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 718 | 1124 | 1.0E-23 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10451|PPR5_SCHPO | Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 | 735 | 1153 | 6.0E-72 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 721 | 1125 | 6.0E-26 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 718 | 1134 | 1.0E-24 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 718 | 1116 | 7.0E-24 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 718 | 1124 | 1.0E-23 |
| sp|Q9ZUU3|PP190_ARATH | Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 | 718 | 1136 | 1.0E-23 |
| sp|Q8S9D1|PP395_ARATH | Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 | 659 | 1115 | 2.0E-23 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 719 | 1095 | 2.0E-23 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 718 | 1095 | 1.0E-22 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 718 | 1102 | 2.0E-22 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 726 | 1108 | 3.0E-22 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 685 | 1092 | 2.0E-21 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 795 | 1131 | 1.0E-20 |
| sp|Q3ECK2|PPR92_ARATH | Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 | 718 | 1095 | 2.0E-20 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 729 | 1116 | 2.0E-20 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 719 | 1150 | 2.0E-20 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 718 | 1116 | 3.0E-20 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 718 | 1095 | 4.0E-20 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 716 | 1135 | 5.0E-20 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 775 | 1145 | 9.0E-20 |
| sp|O81908|PPR2_ARATH | Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 | 796 | 1136 | 1.0E-19 |
| sp|Q9LPX2|PPR39_ARATH | Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 | 716 | 1105 | 2.0E-19 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 718 | 1138 | 2.0E-19 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 721 | 1105 | 3.0E-19 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 789 | 1135 | 7.0E-19 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 805 | 1091 | 7.0E-19 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 776 | 1105 | 2.0E-18 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 718 | 1111 | 2.0E-18 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 712 | 1131 | 2.0E-18 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 812 | 1117 | 3.0E-18 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 717 | 1134 | 3.0E-18 |
| sp|Q9LUR2|PP238_ARATH | Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 | 851 | 1111 | 3.0E-18 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 718 | 1152 | 4.0E-18 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 716 | 1135 | 5.0E-18 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 726 | 1141 | 5.0E-18 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 832 | 1108 | 5.0E-18 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 717 | 1081 | 7.0E-18 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 716 | 1138 | 7.0E-18 |
| sp|Q9LPX2|PPR39_ARATH | Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 | 717 | 1152 | 8.0E-18 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 720 | 1157 | 8.0E-18 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 716 | 1116 | 9.0E-18 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 721 | 1124 | 9.0E-18 |
| sp|Q9FMD3|PP389_ARATH | Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 | 836 | 1141 | 2.0E-17 |
| sp|Q8L844|PP413_ARATH | Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 | 718 | 1105 | 3.0E-17 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 720 | 1152 | 4.0E-17 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 716 | 1131 | 4.0E-17 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 812 | 1137 | 5.0E-17 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 700 | 1115 | 5.0E-17 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 718 | 1118 | 7.0E-17 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 721 | 1096 | 8.0E-17 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 785 | 1141 | 9.0E-17 |
| sp|Q9T0D6|PP306_ARATH | Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 | 776 | 1123 | 1.0E-16 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 718 | 1068 | 1.0E-16 |
| sp|Q9LUR2|PP238_ARATH | Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 | 702 | 1041 | 2.0E-16 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 851 | 1121 | 2.0E-16 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 732 | 1134 | 3.0E-16 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 706 | 1080 | 3.0E-16 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 720 | 1145 | 3.0E-16 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 721 | 1141 | 3.0E-16 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 647 | 1152 | 4.0E-16 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 758 | 1114 | 4.0E-16 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 719 | 1098 | 4.0E-16 |
| sp|Q9FLL3|PP412_ARATH | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 | 718 | 1104 | 4.0E-16 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 719 | 1107 | 6.0E-16 |
| sp|Q9SHK2|PPR17_ARATH | Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 | 718 | 1083 | 6.0E-16 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 712 | 1095 | 7.0E-16 |
| sp|Q9LSQ2|PP239_ARATH | Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 | 693 | 1145 | 1.0E-15 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 716 | 1124 | 1.0E-15 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 822 | 1151 | 2.0E-15 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 717 | 1116 | 2.0E-15 |
| sp|Q9SZ20|PP339_ARATH | Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 | 815 | 1095 | 2.0E-15 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 220 | 1009 | 3.0E-15 |
| sp|Q9ZUE9|PP149_ARATH | Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 | 822 | 1105 | 3.0E-15 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 779 | 1155 | 3.0E-15 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 647 | 1116 | 5.0E-15 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 668 | 1085 | 5.0E-15 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 708 | 1105 | 5.0E-15 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 609 | 1135 | 6.0E-15 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 721 | 1115 | 7.0E-15 |
| sp|Q8L844|PP413_ARATH | Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 | 719 | 1135 | 7.0E-15 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 810 | 1115 | 9.0E-15 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 382 | 1034 | 1.0E-14 |
| sp|Q0WKZ3|PP105_ARATH | Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 | 851 | 1096 | 1.0E-14 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 786 | 1092 | 1.0E-14 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 716 | 1114 | 2.0E-14 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 718 | 1141 | 2.0E-14 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 836 | 1135 | 3.0E-14 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 635 | 1135 | 4.0E-14 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 726 | 1081 | 4.0E-14 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 706 | 1123 | 4.0E-14 |
| sp|O04491|PPR26_ARATH | Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 | 765 | 1135 | 5.0E-14 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 812 | 1111 | 6.0E-14 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 541 | 1038 | 6.0E-14 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 718 | 1068 | 6.0E-14 |
| sp|Q9FLL3|PP412_ARATH | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 | 708 | 970 | 7.0E-14 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 696 | 1107 | 1.0E-13 |
| sp|Q84J71|PP161_ARATH | Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 | 718 | 970 | 1.0E-13 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 839 | 1095 | 2.0E-13 |
| sp|Q5G1S8|PP241_ARATH | Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 | 784 | 1131 | 2.0E-13 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 717 | 1152 | 3.0E-13 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 837 | 1132 | 3.0E-13 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 843 | 1095 | 4.0E-13 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 840 | 1145 | 5.0E-13 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 717 | 1136 | 5.0E-13 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 686 | 1067 | 6.0E-13 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 839 | 1141 | 6.0E-13 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 721 | 1141 | 7.0E-13 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 718 | 1152 | 8.0E-13 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 718 | 1060 | 8.0E-13 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 706 | 970 | 9.0E-13 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 718 | 1069 | 1.0E-12 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 718 | 971 | 1.0E-12 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 713 | 1115 | 1.0E-12 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 720 | 1135 | 1.0E-12 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 781 | 1141 | 2.0E-12 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 722 | 1094 | 2.0E-12 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 820 | 1103 | 2.0E-12 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 692 | 1157 | 2.0E-12 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 786 | 1034 | 2.0E-12 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 839 | 1140 | 2.0E-12 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 349 | 1094 | 3.0E-12 |
| sp|Q9LUR2|PP238_ARATH | Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 | 712 | 1106 | 3.0E-12 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 813 | 1134 | 3.0E-12 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 795 | 1141 | 3.0E-12 |
| sp|O49436|PP327_ARATH | Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 | 718 | 974 | 3.0E-12 |
| sp|O49436|PP327_ARATH | Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 | 821 | 1137 | 3.0E-12 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 715 | 1007 | 3.0E-12 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 720 | 1072 | 4.0E-12 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 647 | 1035 | 5.0E-12 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 701 | 1154 | 5.0E-12 |
| sp|Q9FNL2|PP418_ARATH | Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 | 718 | 972 | 5.0E-12 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 717 | 1152 | 6.0E-12 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 795 | 1135 | 6.0E-12 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 715 | 1145 | 6.0E-12 |
| sp|Q9FFE3|PP388_ARATH | Pentatricopeptide repeat-containing protein At5g16420, mitochondrial OS=Arabidopsis thaliana GN=At5g16420 PE=2 SV=1 | 840 | 1096 | 6.0E-12 |
| sp|Q9FGR7|PP426_ARATH | Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 | 787 | 1124 | 6.0E-12 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 715 | 1006 | 8.0E-12 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 372 | 970 | 9.0E-12 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 718 | 971 | 1.0E-11 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 733 | 1097 | 1.0E-11 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 668 | 1136 | 1.0E-11 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 801 | 1047 | 1.0E-11 |
| sp|Q0WLC6|PP349_ARATH | Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 | 708 | 970 | 1.0E-11 |
| sp|Q8GZ63|PP397_ARATH | Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 | 718 | 1121 | 1.0E-11 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 843 | 1131 | 1.0E-11 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 706 | 1067 | 2.0E-11 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 853 | 1145 | 2.0E-11 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 726 | 1115 | 2.0E-11 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 694 | 1086 | 2.0E-11 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 719 | 1135 | 2.0E-11 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 796 | 1081 | 2.0E-11 |
| sp|Q8RWS8|PP199_ARATH | Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 | 708 | 1069 | 2.0E-11 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 798 | 1096 | 3.0E-11 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 711 | 973 | 3.0E-11 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 689 | 1047 | 3.0E-11 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 823 | 1137 | 4.0E-11 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 714 | 1091 | 4.0E-11 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 718 | 1118 | 4.0E-11 |
| sp|Q5G1S8|PP241_ARATH | Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 | 226 | 1009 | 4.0E-11 |
| sp|Q9FNL2|PP418_ARATH | Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 | 839 | 1135 | 4.0E-11 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 715 | 1135 | 4.0E-11 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 719 | 1067 | 5.0E-11 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 812 | 1091 | 5.0E-11 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 736 | 971 | 5.0E-11 |
| sp|Q3E9F0|PP392_ARATH | Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 | 740 | 1091 | 5.0E-11 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 854 | 1134 | 6.0E-11 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 732 | 1107 | 6.0E-11 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 717 | 1134 | 6.0E-11 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 788 | 1100 | 7.0E-11 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 708 | 1134 | 9.0E-11 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 718 | 1096 | 9.0E-11 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 812 | 1115 | 9.0E-11 |
| sp|Q8S9D1|PP395_ARATH | Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 | 579 | 976 | 1.0E-10 |
| sp|Q9LSQ2|PP239_ARATH | Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 | 803 | 1108 | 1.0E-10 |
| sp|Q9SUD8|PP340_ARATH | Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 | 836 | 1099 | 1.0E-10 |
| sp|Q9LUD6|PP230_ARATH | Pentatricopeptide repeat-containing protein At3g14580, mitochondrial OS=Arabidopsis thaliana GN=At3g14580 PE=2 SV=1 | 796 | 1007 | 1.0E-10 |
| sp|Q9LFQ4|PP383_ARATH | Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 | 741 | 1057 | 1.0E-10 |
| sp|Q9M1D8|PP288_ARATH | Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 | 807 | 1079 | 1.0E-10 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 821 | 1116 | 2.0E-10 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 839 | 1145 | 2.0E-10 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 231 | 519 | 2.0E-10 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 718 | 1115 | 2.0E-10 |
| sp|Q9SAA6|PPR34_ARATH | Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 | 785 | 1098 | 2.0E-10 |
| sp|Q9ZUA2|PP141_ARATH | Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 | 736 | 1140 | 2.0E-10 |
| sp|Q9SAH2|PP137_ARATH | Pentatricopeptide repeat-containing protein At1g80880, mitochondrial OS=Arabidopsis thaliana GN=At1g80880 PE=2 SV=1 | 835 | 1146 | 2.0E-10 |
| sp|P0C043|PP318_ARATH | Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 | 807 | 1112 | 2.0E-10 |
| sp|Q9M8M3|PP136_ARATH | Pentatricopeptide repeat-containing protein At1g80550, mitochondrial OS=Arabidopsis thaliana GN=At1g80550 PE=2 SV=1 | 774 | 1034 | 2.0E-10 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 795 | 1063 | 2.0E-10 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 803 | 1118 | 3.0E-10 |
| sp|Q9LS88|PP250_ARATH | Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 | 840 | 1091 | 3.0E-10 |
| sp|Q9SAD9|PPR40_ARATH | Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 | 711 | 1096 | 3.0E-10 |
| sp|Q9ZVX5|PP156_ARATH | Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 | 694 | 1135 | 3.0E-10 |
| sp|Q56XR6|PP421_ARATH | Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 | 694 | 1027 | 3.0E-10 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 705 | 1091 | 3.0E-10 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 851 | 1134 | 4.0E-10 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 840 | 1115 | 4.0E-10 |
| sp|Q9FGR7|PP426_ARATH | Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 | 815 | 1095 | 4.0E-10 |
| sp|Q8RWS8|PP199_ARATH | Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 | 839 | 1115 | 4.0E-10 |
| sp|Q9LKU8|PP401_ARATH | Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 | 809 | 1154 | 4.0E-10 |
| sp|Q9M316|PP292_ARATH | Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 | 809 | 1154 | 4.0E-10 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 838 | 1138 | 5.0E-10 |
| sp|Q9MAG8|PPR79_ARATH | Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 | 719 | 998 | 5.0E-10 |
| sp|Q0WP85|PP150_ARATH | Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1 | 801 | 1068 | 5.0E-10 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 640 | 1095 | 6.0E-10 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 604 | 1099 | 6.0E-10 |
| sp|Q84J71|PP161_ARATH | Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 | 838 | 1116 | 6.0E-10 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 717 | 980 | 6.0E-10 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 657 | 1060 | 6.0E-10 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 838 | 1145 | 7.0E-10 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 240 | 422 | 8.0E-10 |
| sp|Q9M1D8|PP288_ARATH | Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 | 773 | 1007 | 9.0E-10 |
| sp|Q56XR6|PP421_ARATH | Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 | 721 | 1112 | 9.0E-10 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 807 | 1140 | 1.0E-09 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 690 | 961 | 1.0E-09 |
| sp|Q9SUD8|PP340_ARATH | Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 | 648 | 1108 | 1.0E-09 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 832 | 1135 | 1.0E-09 |
| sp|Q9FVX2|PP129_ARATH | Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 | 718 | 1006 | 1.0E-09 |
| sp|Q84VG6|PP160_ARATH | Pentatricopeptide repeat-containing protein At2g17525, mitochondrial OS=Arabidopsis thaliana GN=At2g17525 PE=2 SV=2 | 781 | 1082 | 1.0E-09 |
| sp|Q6NKW7|PP164_ARATH | Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 | 721 | 1043 | 1.0E-09 |
| sp|Q9SFV9|PP218_ARATH | Pentatricopeptide repeat-containing protein At3g07290, mitochondrial OS=Arabidopsis thaliana GN=At3g07290 PE=2 SV=1 | 644 | 1092 | 1.0E-09 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 366 | 921 | 2.0E-09 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 706 | 927 | 2.0E-09 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 839 | 1141 | 2.0E-09 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 833 | 1094 | 2.0E-09 |
| sp|Q9SAH2|PP137_ARATH | Pentatricopeptide repeat-containing protein At1g80880, mitochondrial OS=Arabidopsis thaliana GN=At1g80880 PE=2 SV=1 | 720 | 970 | 2.0E-09 |
| sp|A3KPF8|PP131_ARATH | Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 | 849 | 1091 | 2.0E-09 |
| sp|P0C7R3|PP106_ARATH | Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 | 718 | 1069 | 2.0E-09 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 821 | 1145 | 3.0E-09 |
| sp|Q9FMD3|PP389_ARATH | Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 | 718 | 1007 | 3.0E-09 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 852 | 1099 | 3.0E-09 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 812 | 969 | 3.0E-09 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 718 | 1007 | 3.0E-09 |
| sp|Q9SSR6|PPR78_ARATH | Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 | 838 | 1137 | 3.0E-09 |
| sp|Q1PFC5|PP130_ARATH | Pentatricopeptide repeat-containing protein At1g77405 OS=Arabidopsis thaliana GN=At1g77405 PE=2 SV=1 | 861 | 1068 | 3.0E-09 |
| sp|Q9S7Q2|PP124_ARATH | Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 | 714 | 1063 | 3.0E-09 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 854 | 1145 | 4.0E-09 |
| sp|O81908|PPR2_ARATH | Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 | 859 | 1134 | 4.0E-09 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 784 | 1082 | 4.0E-09 |
| sp|Q9SZ10|PP338_ARATH | Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 | 839 | 1137 | 4.0E-09 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 274 | 829 | 5.0E-09 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 689 | 1135 | 5.0E-09 |
| sp|Q9MAG8|PPR79_ARATH | Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 | 835 | 1135 | 6.0E-09 |
| sp|Q9S7Q2|PP124_ARATH | Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 | 803 | 1114 | 6.0E-09 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 705 | 1034 | 6.0E-09 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 836 | 1134 | 7.0E-09 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 852 | 1145 | 8.0E-09 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 799 | 1009 | 8.0E-09 |
| sp|Q9SZ10|PP338_ARATH | Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 | 838 | 1081 | 8.0E-09 |
| sp|Q3E9F0|PP392_ARATH | Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 | 885 | 1096 | 9.0E-09 |
| sp|Q3ECK2|PPR92_ARATH | Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 | 232 | 440 | 1.0E-08 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 844 | 1145 | 1.0E-08 |
| sp|Q8GZ63|PP397_ARATH | Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 | 801 | 1141 | 1.0E-08 |
| sp|Q9ZVX5|PP156_ARATH | Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 | 801 | 1111 | 1.0E-08 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 718 | 1081 | 1.0E-08 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 801 | 1095 | 1.0E-08 |
| sp|O82178|PP186_ARATH | Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 | 801 | 1011 | 1.0E-08 |
| sp|Q9SAB4|PPR33_ARATH | Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana GN=At1g11630 PE=2 SV=1 | 833 | 1070 | 1.0E-08 |
| sp|Q9LQQ1|PPR20_ARATH | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 | 786 | 992 | 1.0E-08 |
| sp|Q9LS25|PP420_ARATH | Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 | 715 | 959 | 1.0E-08 |
| sp|Q9LK58|PP225_ARATH | Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana GN=At3g13150 PE=2 SV=1 | 837 | 1060 | 1.0E-08 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 226 | 493 | 2.0E-08 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 793 | 1141 | 2.0E-08 |
| sp|O04491|PPR26_ARATH | Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 | 719 | 1009 | 2.0E-08 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 808 | 1081 | 2.0E-08 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 731 | 1106 | 2.0E-08 |
| sp|Q9S7Q2|PP124_ARATH | Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 | 826 | 1115 | 2.0E-08 |
| sp|Q9LQQ1|PPR20_ARATH | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 | 721 | 1116 | 2.0E-08 |
| sp|Q8L6Y3|PP396_ARATH | Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 | 851 | 1135 | 2.0E-08 |
| sp|Q3ECH5|PP107_ARATH | Pentatricopeptide repeat-containing protein At1g66345, mitochondrial OS=Arabidopsis thaliana GN=At1g66345 PE=3 SV=1 | 864 | 1096 | 2.0E-08 |
| sp|Q8GYP6|PPR49_ARATH | Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 | 788 | 1063 | 2.0E-08 |
| sp|Q9M8W9|PP211_ARATH | Pentatricopeptide repeat-containing protein At3g04130, mitochondrial OS=Arabidopsis thaliana GN=At3g04130 PE=2 SV=2 | 810 | 1063 | 2.0E-08 |
| sp|Q9LFM6|PP375_ARATH | Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 | 762 | 1034 | 2.0E-08 |
| sp|Q9FRS4|PPR22_ARATH | Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 | 718 | 1114 | 2.0E-08 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 231 | 471 | 3.0E-08 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 782 | 1038 | 3.0E-08 |
| sp|Q9LFQ4|PP383_ARATH | Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 | 839 | 1086 | 3.0E-08 |
| sp|Q0WP85|PP150_ARATH | Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1 | 827 | 1136 | 3.0E-08 |
| sp|Q8L6Y3|PP396_ARATH | Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 | 731 | 917 | 3.0E-08 |
| sp|O81028|PP171_ARATH | Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 | 774 | 1145 | 3.0E-08 |
| sp|Q9SAK0|PP132_ARATH | Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 | 793 | 1007 | 3.0E-08 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 240 | 511 | 4.0E-08 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 208 | 514 | 4.0E-08 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 715 | 1102 | 4.0E-08 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 835 | 1141 | 4.0E-08 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 840 | 1115 | 4.0E-08 |
| sp|Q6NKW7|PP164_ARATH | Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 | 796 | 1068 | 4.0E-08 |
| sp|Q6NKW7|PP164_ARATH | Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 | 815 | 1091 | 4.0E-08 |
| sp|P0C7R3|PP106_ARATH | Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 | 843 | 1149 | 4.0E-08 |
| sp|Q9SSR6|PPR78_ARATH | Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 | 785 | 1120 | 4.0E-08 |
| sp|Q9LS25|PP420_ARATH | Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 | 794 | 1069 | 4.0E-08 |
| sp|Q8L6Y3|PP396_ARATH | Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 | 727 | 1094 | 4.0E-08 |
| sp|Q9LEQ7|PP382_ARATH | Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 | 769 | 1013 | 4.0E-08 |
| sp|P0C896|PP209_ARATH | Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 | 861 | 1131 | 4.0E-08 |
| sp|Q3EAF8|PP294_ARATH | Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 | 769 | 1013 | 4.0E-08 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 851 | 1108 | 5.0E-08 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 718 | 917 | 5.0E-08 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 705 | 971 | 5.0E-08 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 220 | 434 | 5.0E-08 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 718 | 917 | 5.0E-08 |
| sp|Q9SAD9|PPR40_ARATH | Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 | 839 | 1094 | 5.0E-08 |
| sp|Q1PFC5|PP130_ARATH | Pentatricopeptide repeat-containing protein At1g77405 OS=Arabidopsis thaliana GN=At1g77405 PE=2 SV=1 | 837 | 1034 | 5.0E-08 |
| sp|Q9FNG8|PP366_ARATH | Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 | 840 | 1135 | 5.0E-08 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 718 | 956 | 6.0E-08 |
| sp|Q9SAD9|PPR40_ARATH | Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 | 859 | 1135 | 6.0E-08 |
| sp|Q9FLD8|PP408_ARATH | Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 | 778 | 1131 | 6.0E-08 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 795 | 1034 | 8.0E-08 |
| sp|Q9M8W9|PP211_ARATH | Pentatricopeptide repeat-containing protein At3g04130, mitochondrial OS=Arabidopsis thaliana GN=At3g04130 PE=2 SV=2 | 778 | 1063 | 8.0E-08 |
| sp|Q9LVD3|PP434_ARATH | Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 | 796 | 1146 | 8.0E-08 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 225 | 471 | 9.0E-08 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 839 | 1141 | 9.0E-08 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 224 | 421 | 1.0E-07 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 840 | 1140 | 1.0E-07 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 825 | 1066 | 1.0E-07 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 220 | 481 | 1.0E-07 |
| sp|Q9ZUA2|PP141_ARATH | Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 | 839 | 1135 | 1.0E-07 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 708 | 970 | 1.0E-07 |
| sp|Q9SAD9|PPR40_ARATH | Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 | 719 | 1096 | 1.0E-07 |
| sp|Q8GYP6|PPR49_ARATH | Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 | 832 | 1135 | 1.0E-07 |
| sp|O81028|PP171_ARATH | Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 | 715 | 1131 | 1.0E-07 |
| sp|Q9FNG8|PP366_ARATH | Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 | 806 | 1044 | 1.0E-07 |
| sp|Q9LVD3|PP434_ARATH | Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 | 812 | 1118 | 1.0E-07 |
| sp|Q7X6A5|PPR81_ARATH | Pentatricopeptide repeat-containing protein At1g55630 OS=Arabidopsis thaliana GN=At1g55630 PE=2 SV=1 | 807 | 1080 | 1.0E-07 |
| sp|Q9LVA2|PP443_ARATH | Pentatricopeptide repeat-containing protein At5g62370 OS=Arabidopsis thaliana GN=At5g62370 PE=2 SV=1 | 647 | 1096 | 1.0E-07 |
| sp|Q9LZP3|PP293_ARATH | Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 | 768 | 1013 | 1.0E-07 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 715 | 1106 | 2.0E-07 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 731 | 977 | 2.0E-07 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 795 | 1091 | 2.0E-07 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 708 | 979 | 2.0E-07 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 226 | 510 | 2.0E-07 |
| sp|P0C896|PP209_ARATH | Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 | 778 | 959 | 2.0E-07 |
| sp|Q9LZP3|PP293_ARATH | Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 | 839 | 1074 | 2.0E-07 |
| sp|Q0WVV0|PPR31_ARATH | Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 | 837 | 1117 | 2.0E-07 |
| sp|Q9FKC3|PP424_ARATH | Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 | 759 | 1115 | 2.0E-07 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 210 | 420 | 3.0E-07 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 648 | 971 | 3.0E-07 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 688 | 902 | 3.0E-07 |
| sp|Q9FVX2|PP129_ARATH | Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 | 859 | 1138 | 3.0E-07 |
| sp|Q8GYP6|PPR49_ARATH | Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 | 702 | 996 | 3.0E-07 |
| sp|Q9C9U0|PP118_ARATH | Pentatricopeptide repeat-containing protein At1g73710 OS=Arabidopsis thaliana GN=At1g73710 PE=2 SV=1 | 796 | 1115 | 3.0E-07 |
| sp|P0C8A0|PP275_ARATH | Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 | 691 | 975 | 3.0E-07 |
| sp|Q8GWE0|PP314_ARATH | Pentatricopeptide repeat-containing protein At4g16390, chloroplastic OS=Arabidopsis thaliana GN=P67 PE=1 SV=3 | 850 | 1154 | 3.0E-07 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 230 | 420 | 4.0E-07 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 731 | 974 | 4.0E-07 |
| sp|Q3E9F0|PP392_ARATH | Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 | 688 | 1012 | 4.0E-07 |
| sp|Q9LIL5|PP233_ARATH | Putative pentatricopeptide repeat-containing protein At3g15200 OS=Arabidopsis thaliana GN=At3g15200 PE=3 SV=1 | 790 | 1055 | 4.0E-07 |
| sp|Q9SCP4|PP279_ARATH | Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=3 SV=1 | 739 | 997 | 4.0E-07 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 231 | 471 | 5.0E-07 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 240 | 431 | 5.0E-07 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 240 | 431 | 5.0E-07 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 739 | 1120 | 5.0E-07 |
| sp|A3KPF8|PP131_ARATH | Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 | 786 | 1138 | 5.0E-07 |
| sp|Q0WKZ3|PP105_ARATH | Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 | 719 | 1007 | 6.0E-07 |
| sp|Q9SAJ5|PP133_ARATH | Pentatricopeptide repeat-containing protein At1g79540 OS=Arabidopsis thaliana GN=At1g79540 PE=2 SV=1 | 721 | 1086 | 6.0E-07 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 719 | 1102 | 8.0E-07 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 231 | 423 | 8.0E-07 |
| sp|Q9MAG8|PPR79_ARATH | Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 | 250 | 425 | 8.0E-07 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 239 | 481 | 9.0E-07 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 844 | 1135 | 9.0E-07 |
| sp|Q0WVV0|PPR31_ARATH | Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 | 715 | 1011 | 9.0E-07 |
| sp|Q8LE47|PPR87_ARATH | Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana GN=PPR336 PE=2 SV=2 | 820 | 1098 | 9.0E-07 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 225 | 475 | 1.0E-06 |
| sp|Q3ECK2|PPR92_ARATH | Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 | 683 | 918 | 1.0E-06 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 220 | 518 | 1.0E-06 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 250 | 425 | 1.0E-06 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 239 | 626 | 1.0E-06 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 716 | 973 | 1.0E-06 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 226 | 513 | 1.0E-06 |
| sp|Q9LQQ1|PPR20_ARATH | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 | 823 | 1107 | 1.0E-06 |
| sp|Q9LEQ7|PP382_ARATH | Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 | 839 | 1074 | 1.0E-06 |
| sp|Q3EAF8|PP294_ARATH | Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 | 839 | 1074 | 1.0E-06 |
| sp|Q9SF38|PP222_ARATH | Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 | 788 | 966 | 1.0E-06 |
| sp|Q9FX35|PP117_ARATH | Pentatricopeptide repeat-containing protein At1g73400, mitochondrial OS=Arabidopsis thaliana GN=At1g73400 PE=2 SV=2 | 879 | 1134 | 1.0E-06 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 231 | 476 | 2.0E-06 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 718 | 980 | 2.0E-06 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 225 | 513 | 2.0E-06 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 239 | 540 | 2.0E-06 |
| sp|Q84VG6|PP160_ARATH | Pentatricopeptide repeat-containing protein At2g17525, mitochondrial OS=Arabidopsis thaliana GN=At2g17525 PE=2 SV=2 | 851 | 1133 | 2.0E-06 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 813 | 1134 | 3.0E-06 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 706 | 971 | 3.0E-06 |
| sp|P0C043|PP318_ARATH | Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 | 811 | 1089 | 3.0E-06 |
| sp|Q56XR6|PP421_ARATH | Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 | 782 | 1131 | 3.0E-06 |
| sp|Q9SF38|PP222_ARATH | Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 | 829 | 1066 | 3.0E-06 |
| sp|Q84J46|PP262_ARATH | Pentatricopeptide repeat-containing protein At3g29290 OS=Arabidopsis thaliana GN=EMB2076 PE=2 SV=1 | 840 | 1069 | 3.0E-06 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 717 | 1081 | 4.0E-06 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 211 | 500 | 4.0E-06 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 643 | 917 | 4.0E-06 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 722 | 1009 | 5.0E-06 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 861 | 1138 | 5.0E-06 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 852 | 1135 | 5.0E-06 |
| sp|Q9SAA6|PPR34_ARATH | Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 | 715 | 1116 | 5.0E-06 |
| sp|Q9SV96|PP358_ARATH | Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 | 854 | 1115 | 6.0E-06 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 819 | 1157 | 7.0E-06 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 664 | 1135 | 7.0E-06 |
| sp|Q9SHK2|PPR17_ARATH | Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 | 719 | 918 | 8.0E-06 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 718 | 918 | 9.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 35 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|1414 MPTIYSSLYTNFIRQGSTFAKSISTHGYAQSVVAATHPHVLNSQNRPLFGRRHTSRLGRLSALHLNSAFHTDRTG TGLSSDQRHGYLHGGLDAYFEALQKKEATGELDKEWTQFEFPKRLEWKPNSSTVLATSEAITSGEDVASAQYEES PALTTEEVAALAHIDAALEKEIEYRKSHEVTENVPAGPSVISASRLTPLTPSSARSQRAVTPPVDSQSQSYADHL SMLSAASRYAEIPAVFEAMLATGVKPIATSYNALLVAAIHLPTKKIEVVSKALDVYADMVRRRVAPNSTTFNILV ELLASRSLEVSEMKNSLETKRVRFGGMDEPGRFMFASHELEHAILCEDDRLDLAIKLFDTATDADAACYSAQTYH QLISACAKAGRVSDMMRLYEHMESHMTAPFAATFPTMIAAFAKRGDLVSAIECYNEYRNLAVANDDGKATLQDRL DSQVYASVVNAYVVSDKAEGAMKFLTKVAAEYGAKFAKMEDDIIGGGFVKGFAARGIYREALEWAKSVSPEARCQ ASARIAMLAADNDDKVAAYEAFEALEANIEMQAAPSIALLAMSIREGDVAAATKHWHALMDPQVRADASLIEPTA MYAVALIGSGQVAQGLAQSKMMFERIRACEATARPQLAEEIDEGVDFIHGFMESRGLGDAREMMSQLSSMPHQTL TASPYLSASTACSYEDAFDPYAHNTDFKGSSLIADDLERKGCRLSEALKRFRNIRRSGRHPRYITYSKLISAAAR ENKMELCDEVLAMARNDVPLLPQYGVVRYGWSSILDAMVGACLNMGNRGGAEKYHQELLDMGAAPSANTFGLYIT TLKDSAKMFDEASEAVRIFHRAKTEGVEPSSFLYNALIGKLGKARRIDDCLFYFAEMRVLGIKPTSVTYGTIVNA LCRVSDEKFAEELFDEMEGMANYKARPAPYNSMMQFFLTTKRDRSKVLEYFERMKSRGIAPTSHTFKLLIDTYAT LEPVEMTAAQGVLDMMGSLGQRPEAVHYASLIHARGCVLHDLDGARELFNSIVDEALVPVNASLFQALFEAMVAN HRVEDTEQLLAQMGERGVELTPYIANTLIHGWAARKNMDKAQGIYDAVALDRREPSTYEAMTRAFLSVDWRERAK GTVGEMLTRGYPGAVVNKVLELLGGGQEVPMA* |
| Coding | >OphauG2|1414 ATGCCCACTATTTACTCTTCACTCTACACGAATTTCATCCGTCAAGGATCAACATTCGCCAAATCCATCTCCACC CACGGCTACGCGCAGTCGGTTGTAGCTGCTACCCACCCCCACGTTCTCAACTCGCAGAACCGCCCCCTTTTCGGT CGTCGGCACACTAGCAGGCTAGGGCGCCTTTCTGCTCTTCACCTCAACTCGGCCTTTCACACAGACCGTACTGGC ACTGGTCTCTCGTCTGACCAACGCCATGGATATCTTCACGGGGGCTTAGATGCCTACTTTGAGGCCCTCCAGAAG AAGGAGGCTACTGGTGAACTTGATAAAGAATGGACTCAGTTTGAGTTTCCTAAGCGGTTGGAATGGAAACCAAAC TCATCTACTGTACTCGCCACCAGTGAGGCTATTACCTCTGGCGAGGATGTCGCCTCAGCCCAATATGAGGAGTCG CCGGCTCTTACTACTGAAGAGGTCGCTGCACTCGCTCACATTGATGCTGCCTTGGAAAAGGAAATTGAGTATAGA AAGTCTCACGAGGTTACCGAAAATGTACCCGCGGGCCCTTCTGTCATCTCGGCTTCCCGTTTAACTCCTCTGACA CCCTCGTCTGCACGGTCACAACGGGCCGTCACACCTCCCGTGGATAGCCAGTCACAATCATACGCAGACCACCTG TCCATGCTGTCGGCTGCATCTCGCTATGCAGAGATTCCAGCCGTATTCGAAGCCATGCTGGCTACAGGAGTCAAG CCCATAGCCACCTCATATAATGCTCTTCTCGTGGCTGCTATTCATCTTCCGACCAAGAAAATTGAAGTCGTCTCC AAGGCCTTGGACGTCTACGCGGACATGGTGAGGCGAAGAGTTGCGCCCAACAGCACAACATTCAACATTCTCGTG GAACTCCTAGCCTCGCGGTCTCTTGAAGTCTCGGAGATGAAAAATTCGCTAGAAACAAAGCGCGTCAGATTCGGA GGCATGGATGAGCCTGGCAGGTTCATGTTCGCCTCTCACGAGCTCGAGCATGCCATCTTGTGCGAAGACGATAGG CTTGATCTGGCCATCAAACTCTTCGATACGGCAACTGACGCTGATGCTGCTTGTTATTCTGCCCAGACATACCAC CAACTCATTTCTGCGTGTGCCAAGGCTGGCCGTGTTTCCGACATGATGCGGCTGTACGAGCACATGGAATCTCAT ATGACGGCTCCCTTTGCGGCCACCTTTCCCACAATGATTGCTGCATTCGCCAAGCGGGGCGATCTCGTTAGTGCT ATCGAGTGCTATAATGAGTATCGTAATTTGGCTGTAGCCAATGATGACGGAAAGGCAACTCTACAAGATAGGCTC GACAGCCAAGTCTATGCATCCGTCGTAAACGCATATGTTGTATCCGACAAGGCCGAGGGTGCCATGAAGTTCTTG ACCAAAGTAGCTGCCGAGTATGGCGCGAAATTTGCCAAGATGGAAGACGACATAATAGGCGGTGGCTTCGTCAAG GGTTTTGCGGCACGGGGCATTTATCGCGAGGCCCTTGAATGGGCCAAGTCGGTTTCTCCTGAAGCTCGATGTCAG GCCAGCGCCAGAATTGCCATGCTCGCTGCAGACAATGATGACAAAGTGGCAGCCTATGAAGCCTTTGAGGCGCTC GAGGCAAATATAGAGATGCAAGCTGCCCCTTCAATAGCTTTGCTTGCCATGAGCATTCGCGAGGGCGATGTTGCT GCAGCTACTAAGCACTGGCATGCTCTCATGGATCCACAAGTACGAGCAGACGCAAGCTTGATAGAGCCCACGGCC ATGTACGCTGTTGCGCTCATTGGGTCCGGTCAAGTCGCCCAAGGCCTGGCTCAGTCAAAAATGATGTTTGAGCGG ATTCGGGCTTGTGAGGCCACGGCGCGGCCTCAGTTGGCGGAAGAAATTGATGAAGGTGTCGACTTTATTCATGGC TTTATGGAAAGTCGCGGGCTTGGCGATGCACGAGAGATGATGTCGCAGCTGTCGAGCATGCCTCATCAGACACTC ACTGCATCGCCTTATCTTTCAGCTTCTACGGCTTGCAGCTACGAGGATGCTTTTGATCCTTATGCTCACAACACG GACTTTAAGGGATCGTCACTCATTGCGGATGATCTTGAGCGCAAGGGATGCCGATTAAGTGAAGCGTTGAAGCGC TTCCGCAACATTCGGCGTTCGGGGCGGCATCCGCGCTACATTACATACTCGAAGCTCATATCTGCTGCAGCTCGC GAGAACAAGATGGAGCTTTGCGATGAAGTGCTTGCCATGGCACGAAATGATGTCCCTCTGCTGCCACAATATGGC GTTGTTCGGTATGGCTGGAGTTCGATTCTCGACGCCATGGTTGGTGCTTGTCTGAACATGGGGAACCGCGGAGGT GCTGAAAAATATCACCAAGAGCTCCTTGACATGGGGGCCGCTCCATCTGCAAACACATTTGGACTTTACATCACG ACTCTCAAGGACTCGGCCAAGATGTTTGACGAAGCATCTGAGGCGGTGCGTATTTTTCACCGTGCCAAGACTGAA GGAGTAGAGCCCAGCTCCTTCTTGTACAATGCTCTGATTGGCAAGCTCGGGAAAGCACGGCGTATCGATGACTGT TTGTTTTACTTTGCTGAAATGAGAGTTTTGGGTATCAAGCCGACGTCGGTTACATATGGTACCATTGTCAATGCT CTTTGCCGAGTCAGCGACGAGAAGTTTGCCGAGGAGCTGTTTGATGAAATGGAAGGCATGGCCAACTACAAGGCT CGGCCAGCTCCTTACAACAGCATGATGCAGTTCTTCTTGACGACTAAGCGCGACCGGAGCAAGGTGCTCGAATAC TTTGAGCGTATGAAGAGTCGGGGCATCGCGCCAACGTCGCACACTTTCAAACTTTTGATTGATACATATGCAACA CTGGAGCCGGTTGAAATGACAGCGGCGCAGGGGGTTCTTGACATGATGGGCTCTTTGGGCCAGCGGCCAGAAGCG GTCCATTACGCCTCACTTATTCATGCTCGGGGCTGTGTACTACACGACTTGGATGGGGCGCGAGAGCTTTTCAAT AGCATTGTGGACGAGGCGCTGGTGCCGGTGAATGCCAGTCTTTTCCAGGCGCTTTTTGAGGCCATGGTGGCCAAC CACCGGGTGGAGGATACGGAGCAACTGTTGGCACAGATGGGTGAAAGAGGGGTAGAGTTGACGCCTTATATTGCC AACACGCTGATTCATGGGTGGGCGGCACGGAAGAATATGGACAAGGCGCAAGGCATCTACGATGCTGTGGCACTA GACAGGCGTGAGCCTAGCACATACGAGGCCATGACCAGGGCCTTTCTTTCAGTCGACTGGCGTGAGCGAGCCAAG GGAACGGTTGGCGAAATGCTGACGCGTGGATACCCTGGTGCTGTGGTTAACAAGGTGTTGGAGCTTCTGGGGGGC GGCCAAGAGGTTCCGATGGCCTAG |
| Transcript | >OphauG2|1414 ATGCCCACTATTTACTCTTCACTCTACACGAATTTCATCCGTCAAGGATCAACATTCGCCAAATCCATCTCCACC CACGGCTACGCGCAGTCGGTTGTAGCTGCTACCCACCCCCACGTTCTCAACTCGCAGAACCGCCCCCTTTTCGGT CGTCGGCACACTAGCAGGCTAGGGCGCCTTTCTGCTCTTCACCTCAACTCGGCCTTTCACACAGACCGTACTGGC ACTGGTCTCTCGTCTGACCAACGCCATGGATATCTTCACGGGGGCTTAGATGCCTACTTTGAGGCCCTCCAGAAG AAGGAGGCTACTGGTGAACTTGATAAAGAATGGACTCAGTTTGAGTTTCCTAAGCGGTTGGAATGGAAACCAAAC TCATCTACTGTACTCGCCACCAGTGAGGCTATTACCTCTGGCGAGGATGTCGCCTCAGCCCAATATGAGGAGTCG CCGGCTCTTACTACTGAAGAGGTCGCTGCACTCGCTCACATTGATGCTGCCTTGGAAAAGGAAATTGAGTATAGA AAGTCTCACGAGGTTACCGAAAATGTACCCGCGGGCCCTTCTGTCATCTCGGCTTCCCGTTTAACTCCTCTGACA CCCTCGTCTGCACGGTCACAACGGGCCGTCACACCTCCCGTGGATAGCCAGTCACAATCATACGCAGACCACCTG TCCATGCTGTCGGCTGCATCTCGCTATGCAGAGATTCCAGCCGTATTCGAAGCCATGCTGGCTACAGGAGTCAAG CCCATAGCCACCTCATATAATGCTCTTCTCGTGGCTGCTATTCATCTTCCGACCAAGAAAATTGAAGTCGTCTCC AAGGCCTTGGACGTCTACGCGGACATGGTGAGGCGAAGAGTTGCGCCCAACAGCACAACATTCAACATTCTCGTG GAACTCCTAGCCTCGCGGTCTCTTGAAGTCTCGGAGATGAAAAATTCGCTAGAAACAAAGCGCGTCAGATTCGGA GGCATGGATGAGCCTGGCAGGTTCATGTTCGCCTCTCACGAGCTCGAGCATGCCATCTTGTGCGAAGACGATAGG CTTGATCTGGCCATCAAACTCTTCGATACGGCAACTGACGCTGATGCTGCTTGTTATTCTGCCCAGACATACCAC CAACTCATTTCTGCGTGTGCCAAGGCTGGCCGTGTTTCCGACATGATGCGGCTGTACGAGCACATGGAATCTCAT ATGACGGCTCCCTTTGCGGCCACCTTTCCCACAATGATTGCTGCATTCGCCAAGCGGGGCGATCTCGTTAGTGCT ATCGAGTGCTATAATGAGTATCGTAATTTGGCTGTAGCCAATGATGACGGAAAGGCAACTCTACAAGATAGGCTC GACAGCCAAGTCTATGCATCCGTCGTAAACGCATATGTTGTATCCGACAAGGCCGAGGGTGCCATGAAGTTCTTG ACCAAAGTAGCTGCCGAGTATGGCGCGAAATTTGCCAAGATGGAAGACGACATAATAGGCGGTGGCTTCGTCAAG GGTTTTGCGGCACGGGGCATTTATCGCGAGGCCCTTGAATGGGCCAAGTCGGTTTCTCCTGAAGCTCGATGTCAG GCCAGCGCCAGAATTGCCATGCTCGCTGCAGACAATGATGACAAAGTGGCAGCCTATGAAGCCTTTGAGGCGCTC GAGGCAAATATAGAGATGCAAGCTGCCCCTTCAATAGCTTTGCTTGCCATGAGCATTCGCGAGGGCGATGTTGCT GCAGCTACTAAGCACTGGCATGCTCTCATGGATCCACAAGTACGAGCAGACGCAAGCTTGATAGAGCCCACGGCC ATGTACGCTGTTGCGCTCATTGGGTCCGGTCAAGTCGCCCAAGGCCTGGCTCAGTCAAAAATGATGTTTGAGCGG ATTCGGGCTTGTGAGGCCACGGCGCGGCCTCAGTTGGCGGAAGAAATTGATGAAGGTGTCGACTTTATTCATGGC TTTATGGAAAGTCGCGGGCTTGGCGATGCACGAGAGATGATGTCGCAGCTGTCGAGCATGCCTCATCAGACACTC ACTGCATCGCCTTATCTTTCAGCTTCTACGGCTTGCAGCTACGAGGATGCTTTTGATCCTTATGCTCACAACACG GACTTTAAGGGATCGTCACTCATTGCGGATGATCTTGAGCGCAAGGGATGCCGATTAAGTGAAGCGTTGAAGCGC TTCCGCAACATTCGGCGTTCGGGGCGGCATCCGCGCTACATTACATACTCGAAGCTCATATCTGCTGCAGCTCGC GAGAACAAGATGGAGCTTTGCGATGAAGTGCTTGCCATGGCACGAAATGATGTCCCTCTGCTGCCACAATATGGC GTTGTTCGGTATGGCTGGAGTTCGATTCTCGACGCCATGGTTGGTGCTTGTCTGAACATGGGGAACCGCGGAGGT GCTGAAAAATATCACCAAGAGCTCCTTGACATGGGGGCCGCTCCATCTGCAAACACATTTGGACTTTACATCACG ACTCTCAAGGACTCGGCCAAGATGTTTGACGAAGCATCTGAGGCGGTGCGTATTTTTCACCGTGCCAAGACTGAA GGAGTAGAGCCCAGCTCCTTCTTGTACAATGCTCTGATTGGCAAGCTCGGGAAAGCACGGCGTATCGATGACTGT TTGTTTTACTTTGCTGAAATGAGAGTTTTGGGTATCAAGCCGACGTCGGTTACATATGGTACCATTGTCAATGCT CTTTGCCGAGTCAGCGACGAGAAGTTTGCCGAGGAGCTGTTTGATGAAATGGAAGGCATGGCCAACTACAAGGCT CGGCCAGCTCCTTACAACAGCATGATGCAGTTCTTCTTGACGACTAAGCGCGACCGGAGCAAGGTGCTCGAATAC TTTGAGCGTATGAAGAGTCGGGGCATCGCGCCAACGTCGCACACTTTCAAACTTTTGATTGATACATATGCAACA CTGGAGCCGGTTGAAATGACAGCGGCGCAGGGGGTTCTTGACATGATGGGCTCTTTGGGCCAGCGGCCAGAAGCG GTCCATTACGCCTCACTTATTCATGCTCGGGGCTGTGTACTACACGACTTGGATGGGGCGCGAGAGCTTTTCAAT AGCATTGTGGACGAGGCGCTGGTGCCGGTGAATGCCAGTCTTTTCCAGGCGCTTTTTGAGGCCATGGTGGCCAAC CACCGGGTGGAGGATACGGAGCAACTGTTGGCACAGATGGGTGAAAGAGGGGTAGAGTTGACGCCTTATATTGCC AACACGCTGATTCATGGGTGGGCGGCACGGAAGAATATGGACAAGGCGCAAGGCATCTACGATGCTGTGGCACTA GACAGGCGTGAGCCTAGCACATACGAGGCCATGACCAGGGCCTTTCTTTCAGTCGACTGGCGTGAGCGAGCCAAG GGAACGGTTGGCGAAATGCTGACGCGTGGATACCCTGGTGCTGTGGTTAACAAGGTGTTGGAGCTTCTGGGGGGC GGCCAAGAGGTTCCGATGGCCTAG |
| Gene | >OphauG2|1414 ATGCCCACTATTTACTCTTCACTCTACACGAATTTCATCCGTCAAGGATCAACATTCGCCAAATCCATCTCCACC CACGGCTACGCGCAGTCGGTTGTAGCTGCTACCCACCCCCACGTTCTCAACTCGCAGAACCGCCCCCTTTTCGGT CGTCGGCACACTAGCAGGCTAGGGCGCCTTTCTGCTCTTCACCTCAACTCGGCCTTTCACACAGACCGTACTGGC ACTGGTCTCTCGTCTGACCAACGCCATGGATATCTTCACGGGGGCTTAGATGCCTACTTTGAGGCCCTCCAGAAG AAGGAGGCTACTGGTGAACTTGATAAAGAATGGACTCAGTTTGAGTTTCCTAAGCGGTTGGAATGGAAACCAAAC TCATCTACTGTACTCGCCACCAGTGAGGCTATTACCTCTGGCGAGGATGTCGCCTCAGCCCAATATGAGGAGTCG CCGGCTCTTACTACTGAAGAGGTCGCTGCACTCGCTCACATTGATGCTGCCTTGGAAAAGGAAATTGAGTATAGA AAGTCTCACGAGGTTACCGAAAATGTACCCGCGGGCCCTTCTGTCATCTCGGCTTCCCGTTTAACTCCTCTGACA CCCTCGTCTGCACGGTCACAACGGGCCGTCACACCTCCCGTGGATAGCCAGTCACAATCATACGCAGACCACCTG TCCATGCTGTCGGCTGCATCTCGCTATGCAGAGATTCCAGCCGTATTCGAAGCCATGCTGGCTACAGGAGTCAAG CCCATAGCCACCTCATATAATGCTCTTCTCGTGGCTGCTATTCATCTTCCGACCAAGAAAATTGAAGTCGTCTCC AAGGCCTTGGACGTCTACGCGGACATGGTGAGGCGAAGAGTTGCGCCCAACAGCACAACATTCAACATTCTCGTG GAACTCCTAGCCTCGCGGTCTCTTGAAGTCTCGGAGATGAAAAATTCGCTAGAAACAAAGCGCGTCAGATTCGGA GGCATGGATGAGCCTGGCAGGTTCATGTTCGCCTCTCACGAGCTCGAGCATGCCATCTTGTGCGAAGACGATAGG CTTGATCTGGCCATCAAACTCTTCGATACGGCAACTGACGCTGATGCTGCTTGTTATTCTGCCCAGACATACCAC CAACTCATTTCTGCGTGTGCCAAGGCTGGCCGTGTTTCCGACATGATGCGGCTGTACGAGCACATGGAATCTCAT ATGACGGCTCCCTTTGCGGCCACCTTTCCCACAATGATTGCTGCATTCGCCAAGCGGGGCGATCTCGTTAGTGCT ATCGAGTGCTATAATGAGTATCGTAATTTGGCTGTAGCCAATGATGACGGAAAGGCAACTCTACAAGATAGGCTC GACAGCCAAGTCTATGCATCCGTCGTAAACGCATATGTTGTATCCGACAAGGCCGAGGGTGCCATGAAGTTCTTG ACCAAAGTAGCTGCCGAGTATGGCGCGAAATTTGCCAAGATGGAAGACGACATAATAGGCGGTGGCTTCGTCAAG GGTTTTGCGGCACGGGGCATTTATCGCGAGGCCCTTGAATGGGCCAAGTCGGTTTCTCCTGAAGCTCGATGTCAG GCCAGCGCCAGAATTGCCATGCTCGCTGCAGACAATGATGACAAAGTGGCAGCCTATGAAGCCTTTGAGGCGCTC GAGGCAAATATAGAGATGCAAGCTGCCCCTTCAATAGCTTTGCTTGCCATGAGCATTCGCGAGGGCGATGTTGCT GCAGCTACTAAGCACTGGCATGCTCTCATGGATCCACAAGTACGAGCAGACGCAAGCTTGATAGAGCCCACGGCC ATGTACGCTGTTGCGCTCATTGGGTCCGGTCAAGTCGCCCAAGGCCTGGCTCAGTCAAAAATGATGTTTGAGCGG ATTCGGGCTTGTGAGGCCACGGCGCGGCCTCAGTTGGCGGAAGAAATTGATGAAGGTGTCGACTTTATTCATGGC TTTATGGAAAGTCGCGGGCTTGGCGATGCACGAGAGATGATGTCGCAGCTGTCGAGCATGCCTCATCAGACACTC ACTGCATCGCCTTATCTTTCAGCTTCTACGGCTTGCAGCTACGAGGATGCTTTTGATCCTTATGCTCACAACACG GACTTTAAGGGATCGTCACTCATTGCGGATGATCTTGAGCGCAAGGGATGCCGATTAAGTGAAGCGTTGAAGCGC TTCCGCAACATTCGGCGTTCGGGGCGGCATCCGCGCTACATTACATACTCGAAGCTCATATCTGCTGCAGCTCGC GAGAACAAGATGGAGCTTTGCGATGAAGTGCTTGCCATGGCACGAAATGATGTCCCTCTGCTGCCACAATATGGC GTTGTTCGGTATGGCTGGAGTTCGATTCTCGACGCCATGGTTGGTGCTTGTCTGAACATGGGGAACCGCGGAGGT GCTGAAAAATATCACCAAGAGCTCCTTGACATGGGGGCCGCTCCATCTGCAAACACATTTGGACTTTACATCACG ACTCTCAAGGACTCGGCCAAGATGTTTGACGAAGCATCTGAGGCGGTGCGTATTTTTCACCGTGCCAAGACTGAA GGAGTAGAGCCCAGCTCCTTCTTGTACAATGCTCTGATTGGCAAGCTCGGGAAAGCACGGCGTATCGATGACTGT TTGTTTTACTTTGCTGAAATGAGAGTTTTGGGTATCAAGCCGACGTCGGTTACATATGGTACCATTGTCAATGCT CTTTGCCGAGTCAGCGACGAGAAGTTTGCCGAGGAGCTGTTTGATGAAATGGAAGGCATGGCCAACTACAAGGCT CGGCCAGCTCCTTACAACAGCATGATGCAGTTCTTCTTGACGACTAAGCGCGACCGGAGCAAGGTGCTCGAATAC TTTGAGCGTATGAAGAGTCGGGGCATCGCGCCAACGTCGCACACTTTCAAACTTTTGATTGATACATATGCAACA CTGGAGCCGGTTGAAATGACAGCGGCGCAGGGGGTTCTTGACATGATGGGCTCTTTGGGCCAGCGGCCAGAAGCG GTCCATTACGCCTCACTTATTCATGCTCGGGGCTGTGTACTACACGACTTGGATGGGGCGCGAGAGCTTTTCAAT AGCATTGTGGACGAGGCGCTGGTGCCGGTGAATGCCAGTCTTTTCCAGGCGCTTTTTGAGGCCATGGTGGCCAAC CACCGGGTGGAGGATACGGAGCAACTGTTGGCACAGATGGGTGAAAGAGGGGTAGAGTTGACGCCTTATATTGCC AACACGCTGATTCATGGGTGGGCGGCACGGAAGAATATGGACAAGGCGCAAGGCATCTACGATGCTGTGGCACTA GACAGGCGTGAGCCTAGCACATACGAGGCCATGACCAGGGCCTTTCTTTCAGTCGACTGGCGTGAGCGAGCCAAG GGAACGGTTGGCGAAATGCTGACGCGTGGATACCCTGGTGCTGTGGTTAACAAGGTGTTGGAGCTTCTGGGGGGC GGCCAAGAGGTTCCGATGGCCTAG |