Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|14
Gene name
LocationContig_1:32148..32703
Strand-
Gene length (bp)555
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10241 KxDL Uncharacterized conserved protein 1.5E-25 87 157

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK9|KXD1_KLULA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KXD1 PE=3 SV=1 79 157 2.0E-07
sp|Q6FS55|KXD1_CANGA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KXD1 PE=3 SV=1 70 157 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3271
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|14 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2674
Ophiocordyceps camponoti-floridani Ophcf2|05786
Ophiocordyceps camponoti-rufipedis Ophun1|1138
Ophiocordyceps kimflemingae Ophio5|3058
Ophiocordyceps subramaniannii Hirsu2|5966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|14
MSGPYSAAPYSMPMAVPPKGNQYPTLTQYSLSPPESEDSITSASGVASYSNSGFSASCSSYMGSSSADFDSSGSA
SGVDFQEYMQERFANSFNPIPLDRSMAVQAQTSGKLNAKHRELLDLQKQAQARLAKTRERFQDGMRDAREVRADL
EWTQKKVW*
Coding >OphauG2|14
ATGTCTGGCCCCTACTCAGCTGCCCCTTACTCCATGCCCATGGCTGTCCCACCAAAGGGGAACCAGTATCCCACC
TTGACTCAGTACTCTCTCTCGCCTCCAGAGAGCGAAGACTCAATCACCTCTGCATCTGGTGTCGCTTCATATAGC
AACAGTGGATTCTCAGCCTCTTGTAGCAGCTACATGGGCAGCTCTAGTGCAGATTTCGACAGCAGCGGCTCTGCT
AGCGGCGTCGACTTCCAGGAATACATGCAGGAGCGCTTTGCCAATTCATTCAATCCTATTCCACTCGATCGCAGT
ATGGCGGTTCAAGCACAGACTTCGGGAAAACTCAATGCCAAACATCGAGAGCTTCTTGACCTGCAGAAGCAGGCT
CAGGCGCGTCTCGCCAAGACTCGTGAGCGTTTCCAAGACGGTATGCGCGACGCCCGGGAGGTGCGGGCAGACCTC
GAATGGACGCAGAAGAAGGTTTGGTAA
Transcript >OphauG2|14
ATGTCTGGCCCCTACTCAGCTGCCCCTTACTCCATGCCCATGGCTGTCCCACCAAAGGGGAACCAGTATCCCACC
TTGACTCAGTACTCTCTCTCGCCTCCAGAGAGCGAAGACTCAATCACCTCTGCATCTGGTGTCGCTTCATATAGC
AACAGTGGATTCTCAGCCTCTTGTAGCAGCTACATGGGCAGCTCTAGTGCAGATTTCGACAGCAGCGGCTCTGCT
AGCGGCGTCGACTTCCAGGAATACATGCAGGAGCGCTTTGCCAATTCATTCAATCCTATTCCACTCGATCGCAGT
ATGGCGGTTCAAGCACAGACTTCGGGAAAACTCAATGCCAAACATCGAGAGCTTCTTGACCTGCAGAAGCAGGCT
CAGGCGCGTCTCGCCAAGACTCGTGAGCGTTTCCAAGACGGTATGCGCGACGCCCGGGAGGTGCGGGCAGACCTC
GAATGGACGCAGAAGAAGGTTTGGTAA
Gene >OphauG2|14
ATGTCTGGCCCCTACTCAGCTGCCCCTTACTCCATGCCCATGGCTGTCCCACCAAAGGGGAACCAGTATCCCACC
TTGACTCAGTACTCTCTCTCGCCTCCAGAGAGCGAAGACTCAATCACCTCTGCATCTGGTGTCGCTTCATATAGC
AACAGTGGATTCTCAGCCTCTTGTAGCAGCTACATGGGCAGCTCTAGTGCAGATTTCGACAGCAGCGGCTCTGCT
AGCGGCGTCGACTTCCAGGAATACATGCAGGAGCGCTTTGCCAATTCATTCAATCCTATTCCACTCGATCGCAGT
ATGGCGGTTCAAGCACAGACGTAAGTCAGACACCCTGAGACACTCCCTCCGAAACCAGTCCGGCAACCGAGTTCC
CAGTCTTGACCGTGTTCACGTAGTTCGGGAAAACTCAATGCCAAACATCGAGAGCTTCTTGACCTGCAGAAGCAG
GCTCAGGCGCGTCTCGCCAAGACTCGTGAGCGTTTCCAAGACGGTATGCGCGACGCCCGGGAGGTGCGGGCAGAC
CTCGAATGGACGCAGAAGAAGGTTTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail