Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1398
Gene name
LocationContig_1417:160..1260
Strand+
Gene length (bp)1100
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04124 Dor1 Dor1-like family 1.9E-26 11 168
PF04124 Dor1 Dor1-like family 5.3E-09 207 311

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96WW5|COG8_SCHPO Conserved oligomeric Golgi complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cog8 PE=3 SV=2 49 326 6.0E-14

GO

GO Term Description Terminal node
GO:0017119 Golgi transport complex Yes
GO:0032991 protein-containing complex No
GO:0099023 vesicle tethering complex No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4844
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1398 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4805
Ophiocordyceps camponoti-rufipedis Ophun1|5939
Ophiocordyceps kimflemingae Ophio5|1068
Ophiocordyceps subramaniannii Hirsu2|10871

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1398
MLSTRLPAIAVPRLDRAVDDFCNSVTSSSESDLILRRKQALRFLHNADRLVNVMELPSLLTSAVQASPVNYSAAL
DLHAHVRRLASLHPHSPLVSSILNESDMALGHMAVDLVTVLKAPGLKLAVGLRTVALLRRLVPTILAHIADDALP
TLFLVCRLTTLFKTLTALEPLRELADEERLRQSRHFSQGGDLSRVIQRESDAWSRGQQTERYLRRYIEIFREHGF
AIVSMSKSIEASFASDIPFNNDDPHQDPLAPSPSPLAAFALHLVLLLLETLNIYLPIVRDRTSRDSILTQVLYCA
GSLGRLGADFSMLLASIGVDDWDQLVKRHRLLAGRLESVIGEHRSHD*
Coding >OphauG2|1398
ATGTTATCGACTCGGCTGCCCGCCATAGCTGTACCGCGTCTGGATCGGGCTGTCGATGACTTCTGCAACTCTGTA
ACCTCGTCTAGCGAGAGCGACCTCATATTGCGACGCAAGCAAGCCCTGCGTTTCCTGCACAATGCCGACCGCCTT
GTCAACGTAATGGAGCTACCATCTCTGCTGACCTCGGCCGTCCAGGCGAGCCCCGTCAACTACTCGGCAGCGCTG
GATCTGCATGCCCATGTGCGCCGCCTCGCCTCTCTCCATCCTCATTCGCCCCTCGTTTCCTCCATTCTGAACGAG
TCAGATATGGCGCTGGGCCACATGGCTGTAGATCTCGTCACCGTCCTCAAGGCCCCTGGCCTTAAGCTTGCTGTC
GGTCTGCGTACTGTGGCCTTGCTCCGCCGTCTGGTACCAACCATCTTGGCCCACATCGCTGACGACGCTTTGCCA
ACCCTGTTTCTCGTTTGCCGCTTGACTACGCTTTTCAAGACGCTTACAGCATTGGAGCCTCTGAGAGAGCTGGCT
GATGAGGAGCGGCTTCGCCAATCAAGGCATTTCAGCCAAGGTGGGGACCTCAGCCGTGTCATTCAACGTGAAAGC
GACGCTTGGTCTCGAGGCCAGCAGACAGAGCGCTATCTAAGACGCTACATTGAGATTTTTCGAGAACATGGCTTT
GCCATTGTCTCTATGTCAAAAAGCATCGAGGCTAGTTTTGCCTCTGACATCCCTTTCAACAATGACGATCCTCAT
CAAGACCCTCTCGCCCCATCACCCTCACCTCTCGCGGCCTTTGCTCTCCATCTTGTCCTTCTCTTGCTCGAAACG
CTTAATATATATTTGCCCATAGTCCGAGACAGAACTTCTCGCGACAGCATCCTTACCCAAGTTTTATACTGTGCT
GGCAGCCTCGGTCGACTCGGTGCCGACTTTAGTATGCTCCTAGCTTCCATCGGCGTCGACGATTGGGACCAGCTC
GTCAAGCGCCACCGCCTCTTGGCTGGTCGTCTGGAGTCTGTTATCGGAGAGCATCGCAGCCATGATTAG
Transcript >OphauG2|1398
ATGTTATCGACTCGGCTGCCCGCCATAGCTGTACCGCGTCTGGATCGGGCTGTCGATGACTTCTGCAACTCTGTA
ACCTCGTCTAGCGAGAGCGACCTCATATTGCGACGCAAGCAAGCCCTGCGTTTCCTGCACAATGCCGACCGCCTT
GTCAACGTAATGGAGCTACCATCTCTGCTGACCTCGGCCGTCCAGGCGAGCCCCGTCAACTACTCGGCAGCGCTG
GATCTGCATGCCCATGTGCGCCGCCTCGCCTCTCTCCATCCTCATTCGCCCCTCGTTTCCTCCATTCTGAACGAG
TCAGATATGGCGCTGGGCCACATGGCTGTAGATCTCGTCACCGTCCTCAAGGCCCCTGGCCTTAAGCTTGCTGTC
GGTCTGCGTACTGTGGCCTTGCTCCGCCGTCTGGTACCAACCATCTTGGCCCACATCGCTGACGACGCTTTGCCA
ACCCTGTTTCTCGTTTGCCGCTTGACTACGCTTTTCAAGACGCTTACAGCATTGGAGCCTCTGAGAGAGCTGGCT
GATGAGGAGCGGCTTCGCCAATCAAGGCATTTCAGCCAAGGTGGGGACCTCAGCCGTGTCATTCAACGTGAAAGC
GACGCTTGGTCTCGAGGCCAGCAGACAGAGCGCTATCTAAGACGCTACATTGAGATTTTTCGAGAACATGGCTTT
GCCATTGTCTCTATGTCAAAAAGCATCGAGGCTAGTTTTGCCTCTGACATCCCTTTCAACAATGACGATCCTCAT
CAAGACCCTCTCGCCCCATCACCCTCACCTCTCGCGGCCTTTGCTCTCCATCTTGTCCTTCTCTTGCTCGAAACG
CTTAATATATATTTGCCCATAGTCCGAGACAGAACTTCTCGCGACAGCATCCTTACCCAAGTTTTATACTGTGCT
GGCAGCCTCGGTCGACTCGGTGCCGACTTTAGTATGCTCCTAGCTTCCATCGGCGTCGACGATTGGGACCAGCTC
GTCAAGCGCCACCGCCTCTTGGCTGGTCGTCTGGAGTCTGTTATCGGAGAGCATCGCAGCCATGATTAG
Gene >OphauG2|1398
ATGTTATCGACTCGGCTGCCCGCCATAGTGAATTGCGCCATAGCTTACCTGCGCTTTCCCACAAGATTTTCGAAT
TGCGCCAGGCTGTACCGCGTCTGGATCGGGCTGTCGATGACTTCTGCAACTCTGTAACCTCGTCTAGCGAGAGCG
ACCTCATATTGCGACGCAAGCAAGCCCTGCGTTTCCTGCACAATGCCGACCGCCTTGTCAACGTAATGGAGCTAC
CATCTCTGCTGACCTCGGCCGTCCAGGCGAGCCCCGTCAACTACTCGGCAGCGCTGGATCTGCATGCCCATGTGC
GCCGCCTCGCCTCTCTCCATCCTCATTCGCCCCTCGTTTCCTCCATTCTGAACGAGTCAGATATGGCGCTGGGCC
ACATGGCTGTAGATCTCGTCACCGTCCTCAAGGCCCCTGGCCTTAAGCTTGCTGTCGGTCTGCGTACTGTGGCCT
TGCTCCGCCGTCTGGTACCAACCATCTTGGCCCACATCGCTGACGACGCTTTGCCAACCCTGTTTCTCGTTTGCC
GCTTGACTACGCTTTTCAAGACGCTTACAGCATTGGAGCCTCTGAGAGAGCTGGCTGATGAGGAGCGGCTTCGCC
AATCAAGGCATTTCAGCCAAGGTGGGGACCTCAGCCGTGTCATTCAACGTGAAAGCGACGCTTGGTCTCGAGGCC
AGCAGACAGAGCGCTATCTAAGACGCTACATTGAGATTTTTCGAGAACATGGCTTTGCCATTGTCTCTATGTCAA
AAAGCATCGAGGCTAGTTTTGCCTCTGACATCCCTTTCAACAATGACGATCCTCATCAAGACCCTCTCGCCCCAT
CACCCTCACCTCTCGCGGCCTTTGCTCTCCATCTTGTCCTTCTCTTGCTCGAAACGCTTAATATATATTTGCCCA
TAGTCCGAGACAGAACTTCTCGCGACAGCATCCTTACCCAAGTTTTATACTGTGCTGGCAGCCTCGGTCGACTCG
GTGCCGACTTTAGTATGCTCCTAGCTTCCATCGGCGTCGACGATTGGGACCAGCTCGTCAAGCGCCACCGCCTCT
TGGCTGGTCGTCTGGAGTCTGTTATCGGAGAGCATCGCAGCCATGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail