Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1390
Gene name
LocationContig_1411:283..3670
Strand+
Gene length (bp)3387
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74910|RAF1_SCHPO Rik1-associated factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=raf1 PE=1 SV=1 136 798 5.0E-21
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 546 786 7.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1390 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3696
Ophiocordyceps camponoti-floridani Ophcf2|01580
Ophiocordyceps camponoti-rufipedis Ophun1|1217
Ophiocordyceps kimflemingae Ophio5|5583
Ophiocordyceps subramaniannii Hirsu2|3777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1390
MAKRVVDISALNASVDEPPAKRRCRNQHDSPPQSLKAWAQENIFPLVVEAVRDLRKQDFLVEKIVINAVTQLVGK
SELRARWDANNGLPPPLAHSDALSIARRVVSELKEKPSFQVQPLKPEIIASVEVKRIARRPTWKPRVPPPAARGP
DRPSVPWRQASEAPRHVNRLFGLKKRPYLSATDRQTIRDRVKDTFSRDEIAGPLNTVYHVDFSQHEVAQVLRSLG
RYLNVGGLTSRRDLAAICQSHNVASLVGSCIPGRSAEDVRRFCSDLLAGQAADAHKPRLFSLSRLECNGHEWRNE
QHVGGRLSALLFARQVEGNAGFGRSRCYVNFQDECRKMRHDGFSLIGEFTNCAGDISTMTWLPGGRIICGTTAHS
DSHNQQYNKQGNLLVCSTRLGTLRALADHRIPRPRVDRGENSSDAMRQSQDAWLYSSVVSSDYDEVHGQAFTSSF
DWTVKVWKVGDEGSDMEVVATWQHQGNVNFVAAAKNGSGHVATAADVPKDAVRVYTVKADNVAESGFVTISCSRT
DANESNGKWAYYPATMQWGSAHGTKHLLLVGYSPRSLRGDEADIPEDKRNSGEILLWDSVTRRLVPVLTASTANV
FEVAWHPTLPRFIAATSPCGLHVEARVRTQVHVFQQDFGRPDSPAYSEIQKLDCPAADINELTIKPNSRKHAYVT
AASTDGRVYVWDTAQGDDAIHVLAHGDPLDHVSQDREKEDTGVKLTVWGNTLDRFYTGSSDGLVKVWNVRNLDRP
FVRNLVEAPGSISCGAFSPDGYKLAVGDATGRVFLFSVDKADAYAGHRATVAGRSVRRPQPFIPHAEPPPPGCSA
GPSPGQTIAMYARQTFVESGQLVLHPNPVIGAVQGPGYSATGMFRIDAHLDEDPEAPLLTEFARKQRESEHAMTQ
GLRRRSLRRLRNPVETAQTSDSRLRYQAQHARNLEADEVQGLRQRDPALWRSLCREGALLEADEDWGFCYEEMPD
DDLA*
Coding >OphauG2|1390
ATGGCTAAACGTGTTGTTGATATATCCGCATTGAACGCGTCGGTTGACGAGCCCCCGGCTAAACGACGATGCAGA
AACCAACATGATTCGCCGCCCCAAAGCCTCAAGGCCTGGGCTCAAGAAAACATCTTCCCGCTCGTTGTAGAAGCG
GTTAGAGACCTGCGCAAGCAAGATTTCCTGGTGGAGAAAATCGTCATCAATGCCGTTACGCAGCTCGTGGGCAAG
TCTGAGCTCCGCGCCCGATGGGATGCAAACAATGGGCTGCCGCCGCCGCTTGCCCATAGCGATGCTCTCTCGATT
GCTCGCCGTGTAGTATCTGAGCTCAAAGAAAAACCGTCCTTCCAGGTGCAGCCTTTGAAGCCGGAAATCATCGCC
TCGGTCGAGGTCAAGCGAATAGCGCGCCGGCCGACGTGGAAGCCTCGCGTGCCGCCACCCGCAGCCCGTGGGCCA
GACAGGCCCAGCGTCCCATGGAGACAGGCCTCGGAAGCGCCGCGACATGTCAATAGGCTGTTTGGTCTGAAGAAG
CGGCCCTATCTATCAGCAACAGACCGCCAAACAATCCGGGACAGGGTCAAGGACACGTTTTCACGCGACGAGATT
GCTGGGCCCCTCAATACCGTCTACCACGTCGACTTTTCACAGCATGAAGTGGCCCAGGTGTTGCGGTCGCTCGGC
AGATATCTCAACGTGGGTGGACTGACAAGTCGACGCGATTTAGCCGCCATTTGCCAGAGCCACAACGTTGCTTCT
CTCGTCGGCAGTTGCATCCCAGGACGCAGCGCAGAGGACGTGCGCCGTTTTTGCTCCGATCTCCTCGCTGGGCAA
GCTGCCGATGCTCACAAGCCGCGGCTTTTTTCCTTGTCAAGACTGGAGTGCAATGGCCATGAATGGCGCAATGAG
CAGCATGTCGGGGGGCGCCTTTCAGCGCTGCTTTTTGCGCGACAGGTCGAGGGCAACGCGGGGTTTGGACGGTCC
AGATGCTACGTCAACTTCCAGGACGAGTGTCGCAAGATGCGGCACGATGGCTTCAGCCTTATCGGCGAGTTTACC
AACTGCGCGGGAGACATCTCCACCATGACGTGGCTCCCCGGCGGCAGGATTATTTGCGGCACAACGGCGCACTCG
GACTCGCACAACCAGCAGTACAACAAGCAGGGCAACTTGCTGGTGTGCTCGACGCGCTTGGGGACGCTCCGTGCT
CTGGCCGACCACCGAATACCTCGCCCGCGGGTGGACAGGGGAGAAAACTCGAGCGACGCGATGCGGCAGAGCCAA
GACGCCTGGCTGTACTCATCCGTGGTGTCTTCAGACTACGACGAGGTGCACGGGCAAGCCTTTACATCCAGCTTT
GACTGGACGGTCAAGGTGTGGAAAGTGGGCGACGAGGGCAGCGACATGGAGGTGGTGGCGACTTGGCAGCACCAA
GGCAACGTCAACTTTGTCGCCGCAGCCAAGAACGGATCGGGACACGTGGCGACGGCGGCCGACGTGCCCAAAGAT
GCTGTGCGCGTCTACACGGTCAAGGCGGACAATGTAGCAGAGAGCGGCTTTGTGACGATTTCGTGCTCGCGGACC
GACGCCAACGAGTCGAATGGCAAGTGGGCCTACTATCCCGCCACGATGCAATGGGGCAGCGCGCATGGCACCAAG
CACCTGCTGCTGGTGGGCTACTCGCCGCGGTCGCTCAGGGGCGACGAGGCTGACATTCCCGAAGACAAGAGGAAC
TCGGGCGAGATTCTCCTGTGGGACTCGGTGACGCGGCGGCTGGTGCCGGTGCTTACGGCCAGCACGGCCAATGTG
TTTGAGGTGGCTTGGCACCCGACGCTGCCGCGCTTCATAGCTGCCACGTCGCCCTGCGGGCTGCATGTCGAGGCG
CGGGTGCGCACCCAGGTGCACGTGTTCCAGCAGGACTTTGGCCGCCCCGACAGCCCGGCCTACAGCGAGATCCAG
AAGCTCGACTGTCCGGCGGCCGACATCAACGAGCTGACCATCAAGCCCAATTCGCGCAAGCACGCCTACGTGACG
GCGGCCTCGACTGACGGCCGAGTCTATGTATGGGACACTGCGCAGGGCGACGATGCCATCCACGTCTTGGCCCAC
GGCGACCCGCTCGACCATGTCAGCCAGGACCGAGAAAAGGAGGACACGGGCGTCAAGTTGACCGTCTGGGGCAAT
ACGCTGGACCGCTTCTACACGGGGTCGAGCGACGGGCTTGTCAAGGTGTGGAACGTGCGCAACCTCGACAGGCCC
TTTGTGCGCAACCTGGTGGAGGCTCCCGGCTCCATTTCCTGTGGCGCCTTTTCGCCCGACGGCTACAAGCTGGCT
GTGGGCGATGCCACGGGCCGCGTCTTTCTCTTTTCCGTCGACAAGGCCGACGCGTACGCCGGGCACAGGGCGACG
GTGGCGGGCCGCTCCGTCAGGCGGCCCCAGCCCTTTATCCCGCATGCGGAGCCGCCTCCGCCAGGCTGTAGCGCG
GGCCCCAGTCCTGGGCAGACGATTGCCATGTATGCGCGCCAGACGTTTGTCGAGTCGGGGCAGCTGGTGCTGCAC
CCCAACCCCGTGATTGGGGCAGTGCAAGGGCCGGGGTACTCGGCGACGGGCATGTTTCGTATAGATGCCCATCTG
GATGAGGATCCAGAGGCCCCACTCCTGACTGAGTTTGCTCGGAAGCAGCGTGAGAGTGAGCATGCCATGACACAA
GGCTTGCGCCGGCGCTCGCTTCGGAGGCTGAGGAACCCGGTCGAGACTGCACAGACGAGCGACTCCCGCCTGCGA
TATCAAGCGCAGCATGCCAGAAACCTGGAGGCTGACGAGGTGCAAGGCCTGCGCCAACGTGACCCGGCTCTCTGG
CGCTCGCTGTGTCGCGAGGGGGCTCTTTTGGAGGCTGACGAGGACTGGGGATTTTGCTACGAGGAGATGCCAGAT
GACGACTTGGCCTAA
Transcript >OphauG2|1390
ATGGCTAAACGTGTTGTTGATATATCCGCATTGAACGCGTCGGTTGACGAGCCCCCGGCTAAACGACGATGCAGA
AACCAACATGATTCGCCGCCCCAAAGCCTCAAGGCCTGGGCTCAAGAAAACATCTTCCCGCTCGTTGTAGAAGCG
GTTAGAGACCTGCGCAAGCAAGATTTCCTGGTGGAGAAAATCGTCATCAATGCCGTTACGCAGCTCGTGGGCAAG
TCTGAGCTCCGCGCCCGATGGGATGCAAACAATGGGCTGCCGCCGCCGCTTGCCCATAGCGATGCTCTCTCGATT
GCTCGCCGTGTAGTATCTGAGCTCAAAGAAAAACCGTCCTTCCAGGTGCAGCCTTTGAAGCCGGAAATCATCGCC
TCGGTCGAGGTCAAGCGAATAGCGCGCCGGCCGACGTGGAAGCCTCGCGTGCCGCCACCCGCAGCCCGTGGGCCA
GACAGGCCCAGCGTCCCATGGAGACAGGCCTCGGAAGCGCCGCGACATGTCAATAGGCTGTTTGGTCTGAAGAAG
CGGCCCTATCTATCAGCAACAGACCGCCAAACAATCCGGGACAGGGTCAAGGACACGTTTTCACGCGACGAGATT
GCTGGGCCCCTCAATACCGTCTACCACGTCGACTTTTCACAGCATGAAGTGGCCCAGGTGTTGCGGTCGCTCGGC
AGATATCTCAACGTGGGTGGACTGACAAGTCGACGCGATTTAGCCGCCATTTGCCAGAGCCACAACGTTGCTTCT
CTCGTCGGCAGTTGCATCCCAGGACGCAGCGCAGAGGACGTGCGCCGTTTTTGCTCCGATCTCCTCGCTGGGCAA
GCTGCCGATGCTCACAAGCCGCGGCTTTTTTCCTTGTCAAGACTGGAGTGCAATGGCCATGAATGGCGCAATGAG
CAGCATGTCGGGGGGCGCCTTTCAGCGCTGCTTTTTGCGCGACAGGTCGAGGGCAACGCGGGGTTTGGACGGTCC
AGATGCTACGTCAACTTCCAGGACGAGTGTCGCAAGATGCGGCACGATGGCTTCAGCCTTATCGGCGAGTTTACC
AACTGCGCGGGAGACATCTCCACCATGACGTGGCTCCCCGGCGGCAGGATTATTTGCGGCACAACGGCGCACTCG
GACTCGCACAACCAGCAGTACAACAAGCAGGGCAACTTGCTGGTGTGCTCGACGCGCTTGGGGACGCTCCGTGCT
CTGGCCGACCACCGAATACCTCGCCCGCGGGTGGACAGGGGAGAAAACTCGAGCGACGCGATGCGGCAGAGCCAA
GACGCCTGGCTGTACTCATCCGTGGTGTCTTCAGACTACGACGAGGTGCACGGGCAAGCCTTTACATCCAGCTTT
GACTGGACGGTCAAGGTGTGGAAAGTGGGCGACGAGGGCAGCGACATGGAGGTGGTGGCGACTTGGCAGCACCAA
GGCAACGTCAACTTTGTCGCCGCAGCCAAGAACGGATCGGGACACGTGGCGACGGCGGCCGACGTGCCCAAAGAT
GCTGTGCGCGTCTACACGGTCAAGGCGGACAATGTAGCAGAGAGCGGCTTTGTGACGATTTCGTGCTCGCGGACC
GACGCCAACGAGTCGAATGGCAAGTGGGCCTACTATCCCGCCACGATGCAATGGGGCAGCGCGCATGGCACCAAG
CACCTGCTGCTGGTGGGCTACTCGCCGCGGTCGCTCAGGGGCGACGAGGCTGACATTCCCGAAGACAAGAGGAAC
TCGGGCGAGATTCTCCTGTGGGACTCGGTGACGCGGCGGCTGGTGCCGGTGCTTACGGCCAGCACGGCCAATGTG
TTTGAGGTGGCTTGGCACCCGACGCTGCCGCGCTTCATAGCTGCCACGTCGCCCTGCGGGCTGCATGTCGAGGCG
CGGGTGCGCACCCAGGTGCACGTGTTCCAGCAGGACTTTGGCCGCCCCGACAGCCCGGCCTACAGCGAGATCCAG
AAGCTCGACTGTCCGGCGGCCGACATCAACGAGCTGACCATCAAGCCCAATTCGCGCAAGCACGCCTACGTGACG
GCGGCCTCGACTGACGGCCGAGTCTATGTATGGGACACTGCGCAGGGCGACGATGCCATCCACGTCTTGGCCCAC
GGCGACCCGCTCGACCATGTCAGCCAGGACCGAGAAAAGGAGGACACGGGCGTCAAGTTGACCGTCTGGGGCAAT
ACGCTGGACCGCTTCTACACGGGGTCGAGCGACGGGCTTGTCAAGGTGTGGAACGTGCGCAACCTCGACAGGCCC
TTTGTGCGCAACCTGGTGGAGGCTCCCGGCTCCATTTCCTGTGGCGCCTTTTCGCCCGACGGCTACAAGCTGGCT
GTGGGCGATGCCACGGGCCGCGTCTTTCTCTTTTCCGTCGACAAGGCCGACGCGTACGCCGGGCACAGGGCGACG
GTGGCGGGCCGCTCCGTCAGGCGGCCCCAGCCCTTTATCCCGCATGCGGAGCCGCCTCCGCCAGGCTGTAGCGCG
GGCCCCAGTCCTGGGCAGACGATTGCCATGTATGCGCGCCAGACGTTTGTCGAGTCGGGGCAGCTGGTGCTGCAC
CCCAACCCCGTGATTGGGGCAGTGCAAGGGCCGGGGTACTCGGCGACGGGCATGTTTCGTATAGATGCCCATCTG
GATGAGGATCCAGAGGCCCCACTCCTGACTGAGTTTGCTCGGAAGCAGCGTGAGAGTGAGCATGCCATGACACAA
GGCTTGCGCCGGCGCTCGCTTCGGAGGCTGAGGAACCCGGTCGAGACTGCACAGACGAGCGACTCCCGCCTGCGA
TATCAAGCGCAGCATGCCAGAAACCTGGAGGCTGACGAGGTGCAAGGCCTGCGCCAACGTGACCCGGCTCTCTGG
CGCTCGCTGTGTCGCGAGGGGGCTCTTTTGGAGGCTGACGAGGACTGGGGATTTTGCTACGAGGAGATGCCAGAT
GACGACTTGGCCTAA
Gene >OphauG2|1390
ATGGCTAAACGTGTTGTTGATATATCCGCATTGTAAGGCCCTCTTTTCCCTATATTTCTATTGGGTATATGAGTT
GAATCTATTTTTATCTGATAAGAGCGCGCGCCGCTATATAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NCGACGACGACAAGGACGACGACGGCAAGGACGACGGCAAGTCGACACTGACGGCATTTGTAGTCCCATCTAGTC
AGCCAAAGCCACCTCCACCCGGCGATTCTCTAGCTCGGGTCTCTAAACGCGCAGATAGGAACGCGTCGGTTGACG
AGCCCCCGGCTAAACGACGATGCAGAAACCAACATGATTCGCCGCCCCAAAGCCTCAAGGCCTGGGCTCAAGAAA
ACATCTTCCCGCTCGTTGTAGAAGCGGTTAGAGACCTGCGCAAGCAAGATTTCCTGGTGGAGAAAATCGTCATCA
ATGTCAGCCGACGTCTTTGCCATGACGCCTGTGGCTTAGCTGATGATTGTGGGTGTTTAGGCCGTTACGCAGCTC
GTGGGCAAGTCTGAGCTCCGCGCCCGATGGGATGCAAACAATGGGCTGCCGCCGCCGCTTGCCCATAGCGATGCT
CTCTCGATTGCTCGCCGTGTAGTATCTGAGCTCAAAGAAAAACCGGTTTGTGGCGTTTTGACAAGGCGGCCCGAG
GCAGGGGGGAGGGGCTGACGTTGCAGGATCCAGTCCTTCCAGGTGCAGCCTTTGAAGCCGGAAATCATCGCCTCG
GTCGAGGTCAAGCGAATAGCGCGCCGGCCGACGTGGAAGCCTCGCGTGCCGCCACCCGCAGCCCGTGGGCCAGAC
AGGCCCAGCGTCCCATGGAGACAGGCCTCGGAAGCGCCGCGACATGTCAATAGGCTGTTTGGTCTGAAGAAGCGG
CCCTATCTATCAGCAACAGACCGCCAAACAATCCGGGACAGGGTCAAGGACACGTTTTCACGCGACGAGATTGCT
GGGCCCCTCAATACCGTCTACCACGTCGACTTTTCACAGCATGAAGTGGCCCAGGTGTTGCGGTCGCTCGGCAGA
TATCTCAACGTGGGTGGACTGACAAGTCGACGCGATTTAGCCGCCATTTGCCAGAGCCACAACGTTGCTTCTCTC
GTCGGCAGTTGCATCCCAGGACGCAGCGCAGAGGACGTGCGCCGTTTTTGCTCCGATCTCCTCGCTGGGCAAGCT
GCCGATGCTCACAAGCCGCGGCTTTTTTCCTTGTCAAGACTGGAGTGCAATGGCCATGAATGGCGCAATGAGCAG
CATGTCGGGGGGCGCCTTTCAGCGCTGCTTTTTGCGCGACAGGTCGAGGGCAACGCGGGGTTTGGACGGTCCAGA
TGCTACGTCAACTTCCAGGACGAGTGTCGCAAGATGCGGCACGATGGCTTCAGCCTTATCGGCGAGTTTACCAAC
TGCGCGGGAGACATCTCCACCATGACGTGGCTCCCCGGCGGCAGGATTATTTGCGGCACAACGGCGCACTCGGAC
TCGCACAACCAGCAGTACAACAAGCAGGGCAACTTGCTGGTGTGCTCGACGCGCTTGGGGACGCTCCGTGCTCTG
GCCGACCACCGAATACCTCGCCCGCGGGTGGACAGGGGAGAAAACTCGAGCGACGCGATGCGGCAGAGCCAAGAC
GCCTGGCTGTACTCATCCGTGGTGTCTTCAGACTACGACGAGGTGCACGGGCAAGCCTTTACATCCAGCTTTGAC
TGGACGGTCAAGGTGTGGAAAGTGGGCGACGAGGGCAGCGACATGGAGGTGGTGGCGACTTGGCAGCACCAAGGC
AACGTCAACTTTGTCGCCGCAGCCAAGAACGGATCGGGACACGTGGCGACGGCGGCCGACGTGCCCAAAGATGCT
GTGCGCGTCTACACGGTCAAGGCGGACAATGTAGCAGAGAGCGGCTTTGTGACGATTTCGTGCTCGCGGACCGAC
GCCAACGAGTCGAATGGCAAGTGGGCCTACTATCCCGCCACGATGCAATGGGGCAGCGCGCATGGCACCAAGCAC
CTGCTGCTGGTGGGCTACTCGCCGCGGTCGCTCAGGGGCGACGAGGCTGACATTCCCGAAGACAAGAGGAACTCG
GGCGAGATTCTCCTGTGGGACTCGGTGACGCGGCGGCTGGTGCCGGTGCTTACGGCCAGCACGGCCAATGTGTTT
GAGGTGGCTTGGCACCCGACGCTGCCGCGCTTCATAGCTGCCACGTCGCCCTGCGGGCTGCATGTCGAGGCGCGG
GTGCGCACCCAGGTGCACGTGTTCCAGCAGGACTTTGGCCGCCCCGACAGCCCGGCCTACAGCGAGATCCAGAAG
CTCGACTGTCCGGCGGCCGACATCAACGAGCTGACCATCAAGCCCAATTCGCGCAAGCACGCCTACGTGACGGCG
GCCTCGACTGACGGCCGAGTCTATGTATGGGACACTGCGCAGGGCGACGATGCCATCCACGTCTTGGCCCACGGC
GACCCGCTCGACCATGTCAGCCAGGACCGAGAAAAGGAGGACACGGGCGTCAAGTTGACCGTCTGGGGCAATACG
CTGGACCGCTTCTACACGGGGTCGAGCGACGGGCTTGTCAAGGTGTGGAACGTGCGCAACCTCGACAGGCCCTTT
GTGCGCAACCTGGTGGAGGCTCCCGGCTCCATTTCCTGTGGCGCCTTTTCGCCCGACGGCTACAAGCTGGCTGTG
GGCGATGCCACGGGCCGCGTCTTTCTCTTTTCCGTCGACAAGGCCGACGCGTACGCCGGGCACAGGGCGACGGTG
GCGGGCCGCTCCGTCAGGCGGCCCCAGCCCTTTATCCCGCATGCGGAGCCGCCTCCGCCAGGCTGTAGCGCGGGC
CCCAGTCCTGGGCAGACGATTGCCATGTATGCGCGCCAGACGTTTGTCGAGTCGGGGCAGCTGGTGCTGCACCCC
AACCCCGTGATTGGGGCAGTGCAAGGGCCGGGGTACTCGGCGACGGGCATGTTTCGTATAGATGCCCATCTGGAT
GAGGATCCAGAGGCCCCACTCCTGACTGAGTTTGCTCGGAAGCAGCGTGAGAGTGAGCATGCCATGACACAAGGC
TTGCGCCGGCGCTCGCTTCGGAGGCTGAGGAACCCGGTCGAGACTGCACAGACGAGCGACTCCCGCCTGCGATAT
CAAGCGCAGCATGCCAGAAACCTGGAGGCTGACGAGGTGCAAGGCCTGCGCCAACGTGACCCGGCTCTCTGGCGC
TCGCTGTGTCGCGAGGGGGCTCTTTTGGAGGCTGACGAGGACTGGGGATTTTGCTACGAGGAGATGCCAGATGAC
GACTTGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail