Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1379
Gene name
LocationContig_1409:2533..4012
Strand-
Gene length (bp)1479
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-28 2 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 1 372 3.0E-105
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 1 386 3.0E-94
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 1 369 2.0E-34
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 1 262 2.0E-24
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 1 268 7.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 1 372 3.0E-105
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 1 386 3.0E-94
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 1 369 2.0E-34
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 1 262 2.0E-24
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 1 268 7.0E-19
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 1 175 8.0E-17
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 1 175 3.0E-15
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 19 175 1.0E-13
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 1 181 2.0E-13
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 1 181 3.0E-13
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 3 180 5.0E-13
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 1 188 6.0E-13
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 3 181 1.0E-12
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 9 181 2.0E-12
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 19 151 4.0E-11
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 2 181 2.0E-10
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 1 180 4.0E-10
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 1 183 4.0E-10
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 9 183 4.0E-09
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 1 181 5.0E-09
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 1 151 8.0E-09
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 16 205 2.0E-07
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 1 181 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 42 61 19
2 66 88 22
3 101 123 22
4 138 157 19
5 243 265 22
6 270 292 22
7 304 326 22
8 352 371 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1379
MRQELGFVGNQLTEINTCFTVGYVVGQIPSNLSLHYVRPRKWFPLMMLLWSGLTMVTASVHRPQSIMVIRFFQGI
FEASTFVGTHYVLGAWYTERELGKRSGIFSSSGLAGTMIGGFIQTGIYNSLNGRLGLSGWRWLFIVDGLLGLPVA
LFGLLFFPDTPSTTTASYLTDADKKLALSRVPAVASPSPISLGFLKKVLTSWYWWGFVGLWIVAGEAESFPSNSL
LALYMQDHPVNKYSIAQINNYPTGVSAVGIVSTLFWAALTDYLGGMRYLVGYYIGLTGIATSIMILLASRHPTSP
SSTSVVFAAYYWSGTVYACQATFFAWCNDAMRSEEAAFRGVVLAGMNMGSNAVNAWWSIVFYGCAALSRIIHVKN
KCKRLSLPRLDEGVGMR*
Coding >OphauG2|1379
ATGCGACAGGAGCTTGGGTTCGTCGGCAACCAGCTCACCGAAATCAACACCTGCTTCACTGTGGGTTATGTCGTT
GGTCAGATTCCATCCAACCTCTCGCTTCACTATGTCAGGCCTCGGAAATGGTTTCCACTCATGATGCTTCTTTGG
AGCGGCCTGACCATGGTGACGGCCTCGGTGCACCGGCCGCAGTCCATCATGGTGATTCGCTTCTTCCAGGGCATC
TTTGAGGCGTCGACATTTGTCGGGACTCACTATGTGCTGGGGGCGTGGTATACAGAGCGCGAGCTGGGCAAGCGC
AGCGGCATCTTTAGCTCGTCAGGCCTCGCCGGCACCATGATTGGGGGCTTTATCCAGACCGGCATCTACAATAGT
CTCAATGGCCGGCTGGGCCTTAGCGGATGGCGCTGGCTGTTCATCGTCGACGGGCTCTTGGGACTTCCCGTGGCC
CTTTTTGGGCTCCTGTTTTTCCCAGACACGCCGAGCACCACGACGGCCAGCTACCTGACCGACGCAGACAAGAAG
CTGGCGCTGTCTCGCGTGCCTGCAGTCGCCAGCCCGTCGCCAATAAGCCTCGGGTTTTTGAAAAAGGTGCTGACG
TCTTGGTACTGGTGGGGATTCGTTGGGCTGTGGATCGTTGCTGGAGAGGCTGAATCGTTTCCCTCCAACTCGCTG
CTGGCTCTTTACATGCAAGACCATCCCGTCAACAAGTACAGCATTGCTCAAATCAACAACTACCCGACTGGCGTG
TCGGCTGTTGGCATCGTGTCGACGCTGTTTTGGGCCGCCCTGACGGACTATTTGGGCGGGATGCGATATCTAGTG
GGATATTACATTGGCCTGACGGGCATTGCAACGTCCATTATGATTCTCTTGGCGTCACGTCATCCCACAAGCCCG
TCGTCGACATCAGTCGTTTTTGCAGCTTACTACTGGTCTGGAACCGTGTATGCCTGTCAGGCCACGTTTTTCGCA
TGGTGCAACGACGCCATGCGCAGTGAAGAAGCCGCTTTTCGAGGCGTTGTGCTCGCCGGGATGAACATGGGAAGC
AACGCCGTCAATGCCTGGTGGAGCATTGTCTTTTATGGGTGTGCAGCGCTGTCACGCATCATCCACGTCAAAAAC
AAGTGTAAGCGGCTCTCTTTGCCGCGTCTGGATGAGGGTGTGGGGATGCGGTAA
Transcript >OphauG2|1379
ATGCGACAGGAGCTTGGGTTCGTCGGCAACCAGCTCACCGAAATCAACACCTGCTTCACTGTGGGTTATGTCGTT
GGTCAGATTCCATCCAACCTCTCGCTTCACTATGTCAGGCCTCGGAAATGGTTTCCACTCATGATGCTTCTTTGG
AGCGGCCTGACCATGGTGACGGCCTCGGTGCACCGGCCGCAGTCCATCATGGTGATTCGCTTCTTCCAGGGCATC
TTTGAGGCGTCGACATTTGTCGGGACTCACTATGTGCTGGGGGCGTGGTATACAGAGCGCGAGCTGGGCAAGCGC
AGCGGCATCTTTAGCTCGTCAGGCCTCGCCGGCACCATGATTGGGGGCTTTATCCAGACCGGCATCTACAATAGT
CTCAATGGCCGGCTGGGCCTTAGCGGATGGCGCTGGCTGTTCATCGTCGACGGGCTCTTGGGACTTCCCGTGGCC
CTTTTTGGGCTCCTGTTTTTCCCAGACACGCCGAGCACCACGACGGCCAGCTACCTGACCGACGCAGACAAGAAG
CTGGCGCTGTCTCGCGTGCCTGCAGTCGCCAGCCCGTCGCCAATAAGCCTCGGGTTTTTGAAAAAGGTGCTGACG
TCTTGGTACTGGTGGGGATTCGTTGGGCTGTGGATCGTTGCTGGAGAGGCTGAATCGTTTCCCTCCAACTCGCTG
CTGGCTCTTTACATGCAAGACCATCCCGTCAACAAGTACAGCATTGCTCAAATCAACAACTACCCGACTGGCGTG
TCGGCTGTTGGCATCGTGTCGACGCTGTTTTGGGCCGCCCTGACGGACTATTTGGGCGGGATGCGATATCTAGTG
GGATATTACATTGGCCTGACGGGCATTGCAACGTCCATTATGATTCTCTTGGCGTCACGTCATCCCACAAGCCCG
TCGTCGACATCAGTCGTTTTTGCAGCTTACTACTGGTCTGGAACCGTGTATGCCTGTCAGGCCACGTTTTTCGCA
TGGTGCAACGACGCCATGCGCAGTGAAGAAGCCGCTTTTCGAGGCGTTGTGCTCGCCGGGATGAACATGGGAAGC
AACGCCGTCAATGCCTGGTGGAGCATTGTCTTTTATGGGTGTGCAGCGCTGTCACGCATCATCCACGTCAAAAAC
AAGTGTAAGCGGCTCTCTTTGCCGCGTCTGGATGAGGGTGTGGGGATGCGGTAA
Gene >OphauG2|1379
ATGCGACAGGAGCTTGGGTTCGTCGGCAACCAGCTCACCGAAATCAACACCTGCTTCACTGTGGGGTATGTTTTG
TCTTGCTCTTGCGGAGGCTCCCGTGTCTCCCGTGGCCTCTTTGACAACGGCATGAAGCAATACTCGGCACAGGGG
GGGTGCTGACGAGTCGAGTCGGCAGTTATGTCGTTGGTCAGATTCCATCCAACCTCTCGCTTCACTATGTCAGGC
CTCGGAAATGGTTTCCACTCATGATGCTTCTTTGGAGCGGCCTGACCATGGTGACGGCCTCGGTGCACCGGCCGC
AGTCCATCATGGTGATTCGCTTCTTCCAGGGCATCTTTGAGGCGTCGACATTTGTCGGGACTCACTATGTGCTGG
GGGCGTGGTATACAGAGCGCGAGCTGGGCAAGCGCAGCGGCATCTTTAGCTCGTCAGGCCTCGCCGGCACCATGA
TTGGGGGCTTTATCCAGACCGGCATCTACAATAGTCTCAATGGCCGGCTGGGCCTTAGCGGATGGCGCTGGCTGT
TCATCGTCGACGGGCTCTTGGGACTTCCCGTGGCCCTTTTTGGGCTCCTGTTTTTCCCAGACACGCCGAGCACCA
CGACGGCCAGCTACCTGACCGACGCAGACAAGAAGCTGGCGCTGTCTCGCGTGCCTGCAGTCGCCAGCCCGTCGC
CAATAAGCCTCGGGTTTTTGAAAAAGGTGCTGACGTCTTGGTACTGGTGGGGATTCGTTGGGCTGTGGATCGTTG
CTGGAGAGGCTGAATCGTTTCCCTCCAACTCGCTGCTGGCTCTTTACATGCAAGACCATCCCGTCAACAAGTACA
GCATTGCTCAAATCAACAACTACCCGACTGGCGTGTCGGCTGTTGGCATCGTGTCGACGCTGTTTTGGGCCGCCC
TGACGGACTATTTGGGCGGGATGCGATATCTAGTGGGATATTACATTGGCCTGACGGGCATTGCAACGTCCATTA
TGATTCTCTTGGCGTCACGTCATCCCACAAGCCCGTCGTCGACATCAGTCGTTTTTGCAGCTTACTACTGGTCTG
GAACCGTGTATGCCTGTCAGGCCACGTTTTTCGCATGGTGCAACGACGCCATGCGCAGTGAAGAAGCCGCTTTTC
GAGGCGTTGTGCTCGCCGGGATGAACATGGGAAGCAACGCCGTCAATGCCTGGTGGAGCATTGTCTTTTATGGTG
CCTCGATGGCTCCATGGTTTACAGTATGTTTTGGCCCTTGCGGGATGCCTCCTCTATTTTCTACTCCTTTTTTTT
TTCTCTTTTTTTTTCTTTTTTTTTTTTTACCAAGCCGAGATGCTTTATACTAAGCAACATGTGCAGCGTGGGTTG
TGGGCCATGATTGCTTGTTGTCTGGCATTGGTTACAGGGTGTGCAGCGCTGTCACGCATCATCCACGTCAAAAAC
AAGTGTAAGCGGCTCTCTTTGCCGCGTCTGGATGAGGGTGTGGGGATGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail