Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1373
Gene name
LocationContig_1405:234..3174
Strand-
Gene length (bp)2940
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 1.7E-94 509 840
PF17215 Rrp44_S1 S1 domain 1.3E-27 892 974
PF17216 Rrp44_CSD1 Rrp44-like cold shock domain 8.5E-21 248 380
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 3.8E-16 407 473
PF13638 PIN_4 PIN domain 1.6E-09 88 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 16 977 0.0E+00
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 16 977 0.0E+00
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 17 959 0.0E+00
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 17 959 0.0E+00
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 17 920 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 16 977 0.0E+00
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 16 977 0.0E+00
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 17 959 0.0E+00
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 17 959 0.0E+00
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 17 920 0.0E+00
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 26 979 0.0E+00
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 20 959 6.0E-154
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 20 959 1.0E-153
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 20 959 2.0E-152
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 29 959 8.0E-149
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 18 960 9.0E-148
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 20 959 2.0E-147
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 20 959 7.0E-147
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 18 922 3.0E-143
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 248 932 7.0E-98
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 243 957 3.0E-91
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 236 920 4.0E-85
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 339 924 3.0E-84
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 245 914 2.0E-80
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 237 834 2.0E-79
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 237 834 5.0E-78
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 502 977 1.0E-50
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 370 925 3.0E-48
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 347 959 6.0E-47
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 431 927 1.0E-45
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 430 923 4.0E-44
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 507 923 7.0E-43
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 480 840 2.0E-42
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 413 941 3.0E-42
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 445 959 6.0E-40
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 417 918 6.0E-40
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 430 918 1.0E-39
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 517 959 8.0E-39
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 509 923 2.0E-38
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 509 923 3.0E-38
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 430 959 4.0E-38
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 445 959 2.0E-37
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 246 920 4.0E-33
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 506 925 8.0E-31
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 495 925 2.0E-30
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 269 959 1.0E-29
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 509 956 9.0E-29
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 413 915 3.0E-28
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 490 836 4.0E-28
sp|P56123|RNR_HELPY Ribonuclease R OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnr PE=3 SV=1 486 878 3.0E-26
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 489 840 4.0E-24
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 489 840 2.0E-23
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 431 666 3.0E-23
sp|Q9ZJX9|RNR_HELPJ Ribonuclease R OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnr PE=3 SV=1 503 878 3.0E-23
sp|D0Z8E6|RNB_EDWTE Exoribonuclease 2 OS=Edwardsiella tarda (strain EIB202) GN=rnb PE=3 SV=2 509 914 5.0E-23
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 489 840 7.0E-23
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 489 901 7.0E-23
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 489 901 7.0E-23
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 509 928 8.0E-23
sp|B7LRZ1|RNB_ESCF3 Exoribonuclease 2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rnb PE=3 SV=1 509 910 9.0E-23
sp|A7MMD8|RNB_CROS8 Exoribonuclease 2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnb PE=3 SV=1 509 910 2.0E-22
sp|B4EW02|RNB_PROMH Exoribonuclease 2 OS=Proteus mirabilis (strain HI4320) GN=rnb PE=3 SV=1 509 914 3.0E-22
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 509 910 4.0E-22
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 489 901 5.0E-22
sp|A8AG96|RNB_CITK8 Exoribonuclease 2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rnb PE=3 SV=1 509 896 8.0E-22
sp|D3V184|RNB_XENBS Exoribonuclease 2 OS=Xenorhabdus bovienii (strain SS-2004) GN=rnb PE=3 SV=1 508 922 1.0E-21
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 446 901 2.0E-21
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 452 892 2.0E-21
sp|Q2NST6|RNB_SODGM Exoribonuclease 2 OS=Sodalis glossinidius (strain morsitans) GN=rnb PE=3 SV=1 509 910 2.0E-21
sp|Q7VLX8|RNB_HAEDU Exoribonuclease 2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rnb PE=3 SV=1 509 857 3.0E-21
sp|A8GF49|RNB_SERP5 Exoribonuclease 2 OS=Serratia proteamaculans (strain 568) GN=rnb PE=3 SV=1 509 943 3.0E-21
sp|B7N4A3|RNB_ECOLU Exoribonuclease 2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rnb PE=3 SV=1 509 845 5.0E-21
sp|Q8FHT6|RNB_ECOL6 Exoribonuclease 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnb PE=3 SV=1 509 845 1.0E-20
sp|Q0TI78|RNB_ECOL5 Exoribonuclease 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnb PE=3 SV=1 509 845 1.0E-20
sp|A6T7Z4|RNB_KLEP7 Exoribonuclease 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnb PE=3 SV=1 509 910 1.0E-20
sp|A4WAX5|RNB_ENT38 Exoribonuclease 2 OS=Enterobacter sp. (strain 638) GN=rnb PE=3 SV=1 508 875 1.0E-20
sp|B7UR96|RNB_ECO27 Exoribonuclease 2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnb PE=3 SV=1 509 845 1.0E-20
sp|Q31ZY2|RNB_SHIBS Exoribonuclease 2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rnb PE=3 SV=1 509 845 2.0E-20
sp|B2U0I4|RNB_SHIB3 Exoribonuclease 2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnb PE=3 SV=1 509 845 2.0E-20
sp|P59107|RNB_SHIFL Exoribonuclease 2 OS=Shigella flexneri GN=rnb PE=3 SV=1 509 845 2.0E-20
sp|Q32GP4|RNB_SHIDS Exoribonuclease 2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rnb PE=3 SV=1 509 845 3.0E-20
sp|Q0T5B1|RNB_SHIF8 Exoribonuclease 2 OS=Shigella flexneri serotype 5b (strain 8401) GN=rnb PE=3 SV=1 509 845 3.0E-20
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 541 836 3.0E-20
sp|A1AAQ4|RNB_ECOK1 Exoribonuclease 2 OS=Escherichia coli O1:K1 / APEC GN=rnb PE=3 SV=1 509 845 3.0E-20
sp|B7MLW3|RNB_ECO45 Exoribonuclease 2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnb PE=3 SV=1 509 845 3.0E-20
sp|Q3Z135|RNB_SHISS Exoribonuclease 2 OS=Shigella sonnei (strain Ss046) GN=rnb PE=3 SV=1 509 845 4.0E-20
sp|B6IA03|RNB_ECOSE Exoribonuclease 2 OS=Escherichia coli (strain SE11) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|P30850|RNB_ECOLI Exoribonuclease 2 OS=Escherichia coli (strain K12) GN=rnb PE=1 SV=3 509 845 5.0E-20
sp|B1XBN7|RNB_ECODH Exoribonuclease 2 OS=Escherichia coli (strain K12 / DH10B) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|C4ZTY2|RNB_ECOBW Exoribonuclease 2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|B7NVR1|RNB_ECO7I Exoribonuclease 2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|B7L4C3|RNB_ECO55 Exoribonuclease 2 OS=Escherichia coli (strain 55989 / EAEC) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|A7ZLA9|RNB_ECO24 Exoribonuclease 2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|B7LY47|RNB_ECO8A Exoribonuclease 2 OS=Escherichia coli O8 (strain IAI1) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|B1ITG7|RNB_ECOLC Exoribonuclease 2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|A7ZZM6|RNB_ECOHS Exoribonuclease 2 OS=Escherichia coli O9:H4 (strain HS) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|B1LGE7|RNB_ECOSM Exoribonuclease 2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rnb PE=3 SV=1 509 845 5.0E-20
sp|B5YZR8|RNB_ECO5E Exoribonuclease 2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rnb PE=3 SV=1 509 845 6.0E-20
sp|Q8X7D6|RNB_ECO57 Exoribonuclease 2 OS=Escherichia coli O157:H7 GN=rnb PE=3 SV=1 509 845 6.0E-20
sp|B5XS03|RNB_KLEP3 Exoribonuclease 2 OS=Klebsiella pneumoniae (strain 342) GN=rnb PE=3 SV=1 509 840 1.0E-19
sp|Q7N4F5|RNB_PHOLL Exoribonuclease 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnb PE=3 SV=1 508 922 2.0E-19
sp|Q1LTG8|RNB_BAUCH Exoribonuclease 2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rnb PE=3 SV=1 509 904 2.0E-19
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 404 887 4.0E-19
sp|Q1RC77|RNB_ECOUT Exoribonuclease 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rnb PE=3 SV=1 509 845 5.0E-19
sp|Q8K9Q5|RNB_BUCAP Exoribonuclease 2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnb PE=3 SV=1 509 844 5.0E-19
sp|B4T6U4|RNB_SALNS Exoribonuclease 2 OS=Salmonella newport (strain SL254) GN=rnb PE=3 SV=1 508 875 6.0E-19
sp|A0KFR1|RNB_AERHH Exoribonuclease 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rnb PE=3 SV=1 489 841 7.0E-19
sp|A9MQ20|RNB_SALAR Exoribonuclease 2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rnb PE=3 SV=1 508 875 8.0E-19
sp|Q8Z7C9|RNB_SALTI Exoribonuclease 2 OS=Salmonella typhi GN=rnb PE=3 SV=1 508 875 1.0E-18
sp|B4TJI0|RNB_SALHS Exoribonuclease 2 OS=Salmonella heidelberg (strain SL476) GN=rnb PE=3 SV=1 508 875 1.0E-18
sp|B5FU93|RNB_SALDC Exoribonuclease 2 OS=Salmonella dublin (strain CT_02021853) GN=rnb PE=3 SV=1 508 875 1.0E-18
sp|B5R9Y0|RNB_SALG2 Exoribonuclease 2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rnb PE=3 SV=1 508 875 1.0E-18
sp|B5R490|RNB_SALEP Exoribonuclease 2 OS=Salmonella enteritidis PT4 (strain P125109) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|Q8ZP54|RNB_SALTY Exoribonuclease 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|A9MWU8|RNB_SALPB Exoribonuclease 2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|B4TX11|RNB_SALSV Exoribonuclease 2 OS=Salmonella schwarzengrund (strain CVM19633) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|C0Q3R1|RNB_SALPC Exoribonuclease 2 OS=Salmonella paratyphi C (strain RKS4594) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|Q57NV9|RNB_SALCH Exoribonuclease 2 OS=Salmonella choleraesuis (strain SC-B67) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|B5F571|RNB_SALA4 Exoribonuclease 2 OS=Salmonella agona (strain SL483) GN=rnb PE=3 SV=1 508 875 2.0E-18
sp|B5BIE3|RNB_SALPK Exoribonuclease 2 OS=Salmonella paratyphi A (strain AKU_12601) GN=rnb PE=3 SV=1 508 875 3.0E-18
sp|Q5PCZ6|RNB_SALPA Exoribonuclease 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rnb PE=3 SV=1 508 875 3.0E-18
sp|B0BP37|RNB_ACTPJ Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rnb PE=3 SV=1 508 966 3.0E-18
sp|Q6D5S7|RNB_PECAS Exoribonuclease 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rnb PE=3 SV=1 509 922 4.0E-18
sp|A3N0B9|RNB_ACTP2 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnb PE=3 SV=1 508 966 4.0E-18
sp|B3GXJ4|RNB_ACTP7 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rnb PE=3 SV=1 508 966 9.0E-18
sp|B2VKS8|RNB_ERWT9 Exoribonuclease 2 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rnb PE=3 SV=1 508 922 1.0E-17
sp|A7FI01|RNB_YERP3 Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rnb PE=3 SV=1 508 943 2.0E-17
sp|P57354|RNB_BUCAI Exoribonuclease 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnb PE=3 SV=1 508 914 4.0E-17
sp|Q057Q9|RNB_BUCCC Exoribonuclease 2 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rnb PE=3 SV=1 509 834 4.0E-17
sp|C6DK05|RNB_PECCP Exoribonuclease 2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rnb PE=3 SV=1 496 922 5.0E-17
sp|Q66AH3|RNB_YERPS Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rnb PE=3 SV=1 508 943 8.0E-17
sp|B2K4J2|RNB_YERPB Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rnb PE=3 SV=1 508 943 8.0E-17
sp|B8F4C5|RNB_HAEPS Exoribonuclease 2 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rnb PE=3 SV=1 508 966 1.0E-16
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 509 840 1.0E-16
sp|B8D7G3|RNB_BUCAT Exoribonuclease 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rnb PE=3 SV=1 508 914 2.0E-16
sp|B8D959|RNB_BUCA5 Exoribonuclease 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rnb PE=3 SV=1 508 914 2.0E-16
sp|A4TJ37|RNB_YERPP Exoribonuclease 2 OS=Yersinia pestis (strain Pestoides F) GN=rnb PE=3 SV=1 508 943 4.0E-16
sp|Q1CIZ7|RNB_YERPN Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rnb PE=3 SV=1 508 943 4.0E-16
sp|A9R8T9|RNB_YERPG Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rnb PE=3 SV=1 508 943 4.0E-16
sp|Q8ZED8|RNB_YERPE Exoribonuclease 2 OS=Yersinia pestis GN=rnb PE=3 SV=1 508 943 4.0E-16
sp|Q1C7L1|RNB_YERPA Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rnb PE=3 SV=1 508 943 4.0E-16
sp|B1JKP2|RNB_YERPY Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rnb PE=3 SV=1 508 943 4.0E-16
sp|Q65SI5|RNB_MANSM Exoribonuclease 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rnb PE=3 SV=1 509 857 4.0E-15
sp|A5UFG3|RNB_HAEIG Exoribonuclease 2 OS=Haemophilus influenzae (strain PittGG) GN=rnb PE=3 SV=1 507 841 1.0E-14
sp|P44440|RNB_HAEIN Exoribonuclease 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnb PE=3 SV=1 507 841 3.0E-14
sp|Q89AM0|RNB_BUCBP Exoribonuclease 2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rnb PE=3 SV=1 509 937 4.0E-14
sp|Q4QJL5|RNB_HAEI8 Exoribonuclease 2 OS=Haemophilus influenzae (strain 86-028NP) GN=rnb PE=3 SV=1 507 852 4.0E-14
sp|A1JM34|RNB_YERE8 Exoribonuclease 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rnb PE=3 SV=1 509 840 6.0E-14
sp|A6VN85|RNB_ACTSZ Exoribonuclease 2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rnb PE=3 SV=1 509 869 3.0E-13
sp|Q9CP74|RNB_PASMU Exoribonuclease 2 OS=Pasteurella multocida (strain Pm70) GN=rnb PE=3 SV=1 509 972 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0004518 nuclease activity No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140098 catalytic activity, acting on RNA No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4285
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1373 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5466
Ophiocordyceps camponoti-floridani Ophcf2|04655
Ophiocordyceps camponoti-rufipedis Ophun1|2742
Ophiocordyceps kimflemingae Ophio5|4250
Ophiocordyceps subramaniannii Hirsu2|8753

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1373
MTSLKRSLPGDPLASNISTKVYVRSTRSGKVQKIVQEVYLRTDIPCSSRLCKSCLKNAPKNAAGQSLPFVLSEKP
AGTKTLPQGHYLVPDTNALLNGMDLFEQKCAFFDVIILQTVLEELRNRSLPLYNRLLGLTKSQEKRFYVFFNDFC
LETYVRREPQETVNDRNDRAIRRAVGWYGQHLAHTEASKVPAVVMLSDDGDNVRKARAQGLDACTLSDYVGSLED
GEKLMDMIADTQWSSGSKARMEYAEHYSLSKMMTGVKAGLMHQGIFNVSAYNSLEGSVKVAGFAKALLVVGRESM
NRAVEGDVVVVQLLARDRWKQASARLGDEDMETRSDEGDGSRPAVSDKERKALQEQAKEAHGACEAALQPTAEVV
GVVRRNWRQYVGHVDPLSASSTGSQGRKQESVLVLAMDKKIPKMRLRTRQVPELVGKRLLVAMDGWPRDSRHPVG
HLVRCLGRMETKAAETEALLLEWDVQYRPFPQTVLDCLPAEGHGWRVGPSSDAATWRDRQDLRHLAVCSIDPPGC
QDIDDALHARPLPRGHWEVGVHIADVAHFVAPATPMDAEASIRGTTVYLVDKRIDMLPPLLGTDLCSLKPQVDRL
AFSVVWELDAHAAIVDVRFTKSVIKSRHAFSYHEAQLRIDDASHRDELTAGMRALLMLSKKLRQKRLDAGALSLS
SPEVKVHMDSESADPIDVKTKQALDTNSLVEEFMLLANISVAARIYQAFPAAAMLRRHAAPPPTSFDRLAAQLRV
VKGLDLRCDSSKALADSLDACVDPAEPFFNTLVRIMATRCMMSAEYFCAGAHAYPDFAHYGLASPIYTHFTSPIR
RYADVIAHRQLAAAIGYDAAPHASTRSRARIEAVCKNINVRHRNAQMAARASIAYYVGQALRGAVAQEEAFVINL
FSNAFVVLVPRFGIEGLIRLRDLADPEPSSHFDPDSYTLTLETPRALRIRLFQKVTVKVRDHKDESTGKRGVKME
LLTP*
Coding >OphauG2|1373
ATGACTAGCCTAAAGCGAAGCCTCCCAGGCGACCCATTGGCCTCCAACATTTCAACAAAGGTCTATGTGCGGTCG
ACGCGCAGCGGCAAGGTGCAGAAAATCGTGCAAGAGGTCTATCTCAGGACGGATATTCCCTGCTCGTCCAGACTG
TGCAAGTCGTGTCTCAAGAATGCTCCCAAGAACGCCGCTGGACAAAGCTTGCCGTTTGTGCTCTCAGAGAAGCCC
GCTGGGACAAAGACGCTGCCGCAGGGCCATTACCTGGTTCCCGACACCAATGCGCTGCTCAACGGCATGGACCTG
TTTGAGCAAAAGTGTGCATTTTTCGATGTCATCATCCTCCAGACAGTGCTTGAGGAGCTGCGCAACCGATCGCTG
CCTCTGTACAACCGGCTGCTGGGCTTGACAAAAAGCCAGGAAAAGCGCTTCTATGTCTTTTTCAACGACTTTTGT
CTAGAGACATATGTGAGGCGCGAGCCCCAAGAGACGGTCAATGACCGCAACGACCGCGCGATTAGGCGGGCGGTG
GGTTGGTACGGGCAGCATCTGGCGCATACAGAGGCCAGCAAGGTGCCTGCTGTTGTCATGCTCAGCGACGATGGC
GACAATGTGCGCAAGGCGCGGGCCCAAGGGCTGGATGCCTGTACGCTGAGCGACTATGTTGGGAGTCTCGAGGAT
GGAGAGAAGCTCATGGACATGATTGCCGACACACAATGGTCGAGTGGGAGCAAGGCGCGCATGGAATATGCGGAA
CACTACAGCCTATCCAAGATGATGACGGGGGTCAAGGCGGGACTGATGCACCAGGGCATATTCAACGTGTCGGCC
TACAACTCGCTAGAGGGCTCGGTCAAGGTGGCGGGCTTTGCCAAGGCGCTCTTGGTTGTGGGGCGCGAGAGCATG
AACCGCGCGGTCGAGGGCGACGTGGTTGTGGTGCAGCTGCTGGCGCGGGACAGGTGGAAGCAGGCGTCGGCCAGG
CTTGGCGACGAGGACATGGAGACGCGCAGCGACGAGGGCGACGGCTCTCGGCCGGCCGTGTCGGACAAGGAGCGC
AAGGCGCTGCAGGAGCAGGCCAAGGAAGCGCATGGCGCGTGCGAGGCGGCGCTGCAGCCCACGGCCGAGGTGGTG
GGCGTGGTCAGGCGCAACTGGCGGCAGTACGTGGGCCATGTCGACCCCTTGTCGGCCAGCAGCACGGGCAGCCAG
GGCCGCAAGCAGGAGAGCGTGCTGGTGCTTGCCATGGACAAGAAGATTCCCAAGATGCGGCTGCGCACGCGCCAG
GTGCCGGAGCTGGTGGGCAAGCGCCTGCTGGTGGCCATGGACGGCTGGCCGCGGGACTCGAGGCATCCCGTGGGC
CACCTGGTGCGCTGCCTGGGGCGCATGGAGACCAAGGCGGCCGAGACGGAGGCGCTGCTGCTCGAGTGGGACGTG
CAGTACCGCCCCTTTCCCCAGACCGTGCTGGACTGCCTGCCGGCCGAGGGCCACGGCTGGCGCGTCGGGCCCAGC
AGCGACGCCGCGACGTGGCGCGACCGCCAGGACCTGCGCCACCTGGCCGTCTGCAGCATCGACCCGCCCGGCTGC
CAGGACATTGACGACGCGCTGCACGCGCGCCCGCTGCCGCGAGGCCACTGGGAGGTGGGCGTGCACATTGCCGAC
GTGGCGCACTTTGTCGCGCCGGCCACGCCCATGGACGCCGAGGCCAGCATCCGCGGCACCACCGTCTACCTGGTG
GACAAGCGCATCGACATGCTGCCGCCCCTGCTGGGCACCGACCTGTGCTCGCTCAAGCCCCAGGTCGACCGCCTG
GCCTTTTCCGTCGTCTGGGAGCTCGACGCCCACGCCGCCATTGTCGACGTGCGCTTCACCAAGTCGGTCATCAAG
TCGCGCCACGCCTTTAGCTACCACGAAGCCCAGCTGCGCATCGACGACGCGTCGCACCGCGATGAGCTGACGGCC
GGCATGCGCGCCCTGCTCATGCTGTCCAAGAAGCTGCGCCAGAAGCGTCTCGACGCCGGCGCCCTCAGCCTGTCG
TCGCCCGAAGTCAAGGTGCACATGGACTCCGAGTCGGCCGACCCCATCGACGTCAAGACCAAGCAGGCGCTCGAC
ACCAACTCGCTCGTCGAGGAGTTTATGCTGCTGGCCAACATTAGCGTCGCCGCCCGCATCTACCAGGCCTTTCCC
GCCGCCGCCATGCTGCGCCGCCACGCCGCGCCGCCCCCGACGAGCTTTGACCGCCTCGCCGCCCAGCTGCGCGTC
GTCAAGGGCCTCGACCTGCGCTGCGACTCCAGCAAGGCCCTGGCCGACTCGCTCGACGCCTGTGTCGACCCCGCC
GAGCCCTTCTTCAACACCCTGGTGCGCATCATGGCCACGCGCTGCATGATGAGCGCCGAGTACTTTTGCGCCGGC
GCCCACGCCTATCCCGACTTTGCCCACTACGGCCTCGCCTCGCCCATCTACACCCACTTCACCTCGCCCATCCGC
CGCTACGCAGACGTCATTGCCCATCGCCAGCTGGCCGCTGCCATTGGCTACGACGCCGCCCCCCATGCCTCGACG
CGCAGCCGCGCCCGCATCGAGGCCGTCTGCAAAAACATCAATGTGCGCCACCGCAACGCCCAGATGGCCGCCCGT
GCAAGCATCGCCTACTATGTCGGCCAGGCCCTGCGCGGCGCCGTTGCCCAGGAAGAGGCCTTTGTCATTAATCTT
TTCAGCAATGCCTTTGTCGTCTTGGTCCCGCGCTTTGGCATCGAGGGCCTCATCCGCCTGCGCGACCTGGCCGAC
CCCGAGCCGTCGAGCCACTTTGACCCGGATAGCTATACCCTGACTCTTGAGACCCCAAGGGCCCTGCGCATCCGT
CTCTTTCAAAAAGTCACCGTCAAGGTCCGCGACCACAAGGACGAGAGCACCGGCAAGCGCGGCGTCAAGATGGAG
CTGCTAACGCCCTGA
Transcript >OphauG2|1373
ATGACTAGCCTAAAGCGAAGCCTCCCAGGCGACCCATTGGCCTCCAACATTTCAACAAAGGTCTATGTGCGGTCG
ACGCGCAGCGGCAAGGTGCAGAAAATCGTGCAAGAGGTCTATCTCAGGACGGATATTCCCTGCTCGTCCAGACTG
TGCAAGTCGTGTCTCAAGAATGCTCCCAAGAACGCCGCTGGACAAAGCTTGCCGTTTGTGCTCTCAGAGAAGCCC
GCTGGGACAAAGACGCTGCCGCAGGGCCATTACCTGGTTCCCGACACCAATGCGCTGCTCAACGGCATGGACCTG
TTTGAGCAAAAGTGTGCATTTTTCGATGTCATCATCCTCCAGACAGTGCTTGAGGAGCTGCGCAACCGATCGCTG
CCTCTGTACAACCGGCTGCTGGGCTTGACAAAAAGCCAGGAAAAGCGCTTCTATGTCTTTTTCAACGACTTTTGT
CTAGAGACATATGTGAGGCGCGAGCCCCAAGAGACGGTCAATGACCGCAACGACCGCGCGATTAGGCGGGCGGTG
GGTTGGTACGGGCAGCATCTGGCGCATACAGAGGCCAGCAAGGTGCCTGCTGTTGTCATGCTCAGCGACGATGGC
GACAATGTGCGCAAGGCGCGGGCCCAAGGGCTGGATGCCTGTACGCTGAGCGACTATGTTGGGAGTCTCGAGGAT
GGAGAGAAGCTCATGGACATGATTGCCGACACACAATGGTCGAGTGGGAGCAAGGCGCGCATGGAATATGCGGAA
CACTACAGCCTATCCAAGATGATGACGGGGGTCAAGGCGGGACTGATGCACCAGGGCATATTCAACGTGTCGGCC
TACAACTCGCTAGAGGGCTCGGTCAAGGTGGCGGGCTTTGCCAAGGCGCTCTTGGTTGTGGGGCGCGAGAGCATG
AACCGCGCGGTCGAGGGCGACGTGGTTGTGGTGCAGCTGCTGGCGCGGGACAGGTGGAAGCAGGCGTCGGCCAGG
CTTGGCGACGAGGACATGGAGACGCGCAGCGACGAGGGCGACGGCTCTCGGCCGGCCGTGTCGGACAAGGAGCGC
AAGGCGCTGCAGGAGCAGGCCAAGGAAGCGCATGGCGCGTGCGAGGCGGCGCTGCAGCCCACGGCCGAGGTGGTG
GGCGTGGTCAGGCGCAACTGGCGGCAGTACGTGGGCCATGTCGACCCCTTGTCGGCCAGCAGCACGGGCAGCCAG
GGCCGCAAGCAGGAGAGCGTGCTGGTGCTTGCCATGGACAAGAAGATTCCCAAGATGCGGCTGCGCACGCGCCAG
GTGCCGGAGCTGGTGGGCAAGCGCCTGCTGGTGGCCATGGACGGCTGGCCGCGGGACTCGAGGCATCCCGTGGGC
CACCTGGTGCGCTGCCTGGGGCGCATGGAGACCAAGGCGGCCGAGACGGAGGCGCTGCTGCTCGAGTGGGACGTG
CAGTACCGCCCCTTTCCCCAGACCGTGCTGGACTGCCTGCCGGCCGAGGGCCACGGCTGGCGCGTCGGGCCCAGC
AGCGACGCCGCGACGTGGCGCGACCGCCAGGACCTGCGCCACCTGGCCGTCTGCAGCATCGACCCGCCCGGCTGC
CAGGACATTGACGACGCGCTGCACGCGCGCCCGCTGCCGCGAGGCCACTGGGAGGTGGGCGTGCACATTGCCGAC
GTGGCGCACTTTGTCGCGCCGGCCACGCCCATGGACGCCGAGGCCAGCATCCGCGGCACCACCGTCTACCTGGTG
GACAAGCGCATCGACATGCTGCCGCCCCTGCTGGGCACCGACCTGTGCTCGCTCAAGCCCCAGGTCGACCGCCTG
GCCTTTTCCGTCGTCTGGGAGCTCGACGCCCACGCCGCCATTGTCGACGTGCGCTTCACCAAGTCGGTCATCAAG
TCGCGCCACGCCTTTAGCTACCACGAAGCCCAGCTGCGCATCGACGACGCGTCGCACCGCGATGAGCTGACGGCC
GGCATGCGCGCCCTGCTCATGCTGTCCAAGAAGCTGCGCCAGAAGCGTCTCGACGCCGGCGCCCTCAGCCTGTCG
TCGCCCGAAGTCAAGGTGCACATGGACTCCGAGTCGGCCGACCCCATCGACGTCAAGACCAAGCAGGCGCTCGAC
ACCAACTCGCTCGTCGAGGAGTTTATGCTGCTGGCCAACATTAGCGTCGCCGCCCGCATCTACCAGGCCTTTCCC
GCCGCCGCCATGCTGCGCCGCCACGCCGCGCCGCCCCCGACGAGCTTTGACCGCCTCGCCGCCCAGCTGCGCGTC
GTCAAGGGCCTCGACCTGCGCTGCGACTCCAGCAAGGCCCTGGCCGACTCGCTCGACGCCTGTGTCGACCCCGCC
GAGCCCTTCTTCAACACCCTGGTGCGCATCATGGCCACGCGCTGCATGATGAGCGCCGAGTACTTTTGCGCCGGC
GCCCACGCCTATCCCGACTTTGCCCACTACGGCCTCGCCTCGCCCATCTACACCCACTTCACCTCGCCCATCCGC
CGCTACGCAGACGTCATTGCCCATCGCCAGCTGGCCGCTGCCATTGGCTACGACGCCGCCCCCCATGCCTCGACG
CGCAGCCGCGCCCGCATCGAGGCCGTCTGCAAAAACATCAATGTGCGCCACCGCAACGCCCAGATGGCCGCCCGT
GCAAGCATCGCCTACTATGTCGGCCAGGCCCTGCGCGGCGCCGTTGCCCAGGAAGAGGCCTTTGTCATTAATCTT
TTCAGCAATGCCTTTGTCGTCTTGGTCCCGCGCTTTGGCATCGAGGGCCTCATCCGCCTGCGCGACCTGGCCGAC
CCCGAGCCGTCGAGCCACTTTGACCCGGATAGCTATACCCTGACTCTTGAGACCCCAAGGGCCCTGCGCATCCGT
CTCTTTCAAAAAGTCACCGTCAAGGTCCGCGACCACAAGGACGAGAGCACCGGCAAGCGCGGCGTCAAGATGGAG
CTGCTAACGCCCTGA
Gene >OphauG2|1373
ATGACTAGCCTAAAGCGAAGCCTCCCAGGCGACCCATTGGCCTCCAACATTTCAACAAAGGTCTATGTGCGGTCG
ACGCGCAGCGGCAAGGTGCAGAAAATCGTGCAAGAGGTCTATCTCAGGACGGATATTCCCTGCTCGTCCAGACTG
TGCAAGTCGTGTCTCAAGAATGCTCCCAAGAACGCCGCTGGACAAAGCTTGCCGTTTGTGCTCTCAGAGAAGCCC
GCTGGGACAAAGACGCTGCCGCAGGGCCATTACCTGGTTCCCGACACCAATGCGCTGCTCAACGGCATGGACCTG
TTTGAGCAAAAGTGTGCATTTTTCGATGTCATCATCCTCCAGACAGTGCTTGAGGAGCTGCGCAACCGATCGCTG
CCTCTGTACAACCGGCTGCTGGGCTTGACAAAAAGCCAGGAAAAGCGCTTCTATGTCTTTTTCAACGACTTTTGT
CTAGAGACATATGTGAGGCGCGAGCCCCAAGAGACGGTCAATGACCGCAACGACCGCGCGATTAGGCGGGCGGTG
GGTTGGTACGGGCAGCATCTGGCGCATACAGAGGCCAGCAAGGTGCCTGCTGTTGTCATGCTCAGCGACGATGGC
GACAATGTGCGCAAGGCGCGGGCCCAAGGGCTGGATGCCTGTACGCTGAGCGACTATGTTGGGAGTCTCGAGGAT
GGAGAGAAGCTCATGGACATGATTGCCGACACACAATGGTCGAGTGGGAGCAAGGCGCGCATGGAATATGCGGAA
CACTACAGCCTATCCAAGATGATGACGGGGGTCAAGGCGGGACTGATGCACCAGGGCATATTCAACGTGTCGGCC
TACAACTCGCTAGAGGGCTCGGTCAAGGTGGCGGGCTTTGCCAAGGCGCTCTTGGTTGTGGGGCGCGAGAGCATG
AACCGCGCGGTCGAGGGCGACGTGGTTGTGGTGCAGCTGCTGGCGCGGGACAGGTGGAAGCAGGCGTCGGCCAGG
CTTGGCGACGAGGACATGGAGACGCGCAGCGACGAGGGCGACGGCTCTCGGCCGGCCGTGTCGGACAAGGAGCGC
AAGGCGCTGCAGGAGCAGGCCAAGGAAGCGCATGGCGCGTGCGAGGCGGCGCTGCAGCCCACGGCCGAGGTGGTG
GGCGTGGTCAGGCGCAACTGGCGGCAGTACGTGGGCCATGTCGACCCCTTGTCGGCCAGCAGCACGGGCAGCCAG
GGCCGCAAGCAGGAGAGCGTGCTGGTGCTTGCCATGGACAAGAAGATTCCCAAGATGCGGCTGCGCACGCGCCAG
GTGCCGGAGCTGGTGGGCAAGCGCCTGCTGGTGGCCATGGACGGCTGGCCGCGGGACTCGAGGCATCCCGTGGGC
CACCTGGTGCGCTGCCTGGGGCGCATGGAGACCAAGGCGGCCGAGACGGAGGCGCTGCTGCTCGAGTGGGACGTG
CAGTACCGCCCCTTTCCCCAGACCGTGCTGGACTGCCTGCCGGCCGAGGGCCACGGCTGGCGCGTCGGGCCCAGC
AGCGACGCCGCGACGTGGCGCGACCGCCAGGACCTGCGCCACCTGGCCGTCTGCAGCATCGACCCGCCCGGCTGC
CAGGACATTGACGACGCGCTGCACGCGCGCCCGCTGCCGCGAGGCCACTGGGAGGTGGGCGTGCACATTGCCGAC
GTGGCGCACTTTGTCGCGCCGGCCACGCCCATGGACGCCGAGGCCAGCATCCGCGGCACCACCGTCTACCTGGTG
GACAAGCGCATCGACATGCTGCCGCCCCTGCTGGGCACCGACCTGTGCTCGCTCAAGCCCCAGGTCGACCGCCTG
GCCTTTTCCGTCGTCTGGGAGCTCGACGCCCACGCCGCCATTGTCGACGTGCGCTTCACCAAGTCGGTCATCAAG
TCGCGCCACGCCTTTAGCTACCACGAAGCCCAGCTGCGCATCGACGACGCGTCGCACCGCGATGAGCTGACGGCC
GGCATGCGCGCCCTGCTCATGCTGTCCAAGAAGCTGCGCCAGAAGCGTCTCGACGCCGGCGCCCTCAGCCTGTCG
TCGCCCGAAGTCAAGGTGCACATGGACTCCGAGTCGGCCGACCCCATCGACGTCAAGACCAAGCAGGCGCTCGAC
ACCAACTCGCTCGTCGAGGAGTTTATGCTGCTGGCCAACATTAGCGTCGCCGCCCGCATCTACCAGGCCTTTCCC
GCCGCCGCCATGCTGCGCCGCCACGCCGCGCCGCCCCCGACGAGCTTTGACCGCCTCGCCGCCCAGCTGCGCGTC
GTCAAGGGCCTCGACCTGCGCTGCGACTCCAGCAAGGCCCTGGCCGACTCGCTCGACGCCTGTGTCGACCCCGCC
GAGCCCTTCTTCAACACCCTGGTGCGCATCATGGCCACGCGCTGCATGATGAGCGCCGAGTACTTTTGCGCCGGC
GCCCACGCCTATCCCGACTTTGCCCACTACGGCCTCGCCTCGCCCATCTACACCCACTTCACCTCGCCCATCCGC
CGCTACGCAGACGTCATTGCCCATCGCCAGCTGGCCGCTGCCATTGGCTACGACGCCGCCCCCCATGCCTCGACG
CGCAGCCGCGCCCGCATCGAGGCCGTCTGCAAAAACATCAATGTGCGCCACCGCAACGCCCAGATGGCCGCCCGT
GCAAGCATCGCCTACTATGTCGGCCAGGCCCTGCGCGGCGCCGTTGCCCAGGAAGAGGCCTTTGTCATTAATCTT
TTCAGCAATGCCTTTGTCGTCTTGGTCCCGCGCTTTGGCATCGAGGGCCTCATCCGCCTGCGCGACCTGGCCGAC
CCCGAGCCGTCGAGCCACTTTGACCCGGATAGCTATACCCTGACTCTTGAGACCCCAAGGGCCCTGCGCATCCGT
CTCTTTCAAAAAGTCACCGTCAAGGTCCGCGACCACAAGGACGAGAGCACCGGCAAGCGCGGCGTCAAGATGGAG
CTGCTAACGCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail