Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|137
Gene name
LocationContig_1018:2480..4103
Strand+
Gene length (bp)1623
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03453 MoeA_N MoeA N-terminal region (domain I and II) 5.5E-35 112 286
PF00994 MoCF_biosynth Probable molybdopterin binding domain 1.5E-30 299 449
PF03454 MoeA_C MoeA C-terminal region (domain IV) 8.8E-16 463 532

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens GN=GPHN PE=1 SV=1 102 536 2.0E-94
sp|Q03555|GEPH_RAT Gephyrin OS=Rattus norvegicus GN=Gphn PE=1 SV=3 102 536 4.0E-94
sp|Q8BUV3|GEPH_MOUSE Gephyrin OS=Mus musculus GN=Gphn PE=1 SV=2 102 536 5.0E-94
sp|Q9PW38|GEPH_CHICK Gephyrin OS=Gallus gallus GN=GPHN PE=1 SV=1 102 536 6.0E-86
sp|Q39054|CNX1_ARATH Molybdopterin biosynthesis protein CNX1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=2 140 539 7.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens GN=GPHN PE=1 SV=1 102 536 2.0E-94
sp|Q03555|GEPH_RAT Gephyrin OS=Rattus norvegicus GN=Gphn PE=1 SV=3 102 536 4.0E-94
sp|Q8BUV3|GEPH_MOUSE Gephyrin OS=Mus musculus GN=Gphn PE=1 SV=2 102 536 5.0E-94
sp|Q9PW38|GEPH_CHICK Gephyrin OS=Gallus gallus GN=GPHN PE=1 SV=1 102 536 6.0E-86
sp|Q39054|CNX1_ARATH Molybdopterin biosynthesis protein CNX1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=2 140 539 7.0E-75
sp|Q54KM0|GEPH_DICDI Gephyrin OS=Dictyostelium discoideum GN=gphn PE=3 SV=1 105 537 1.0E-71
sp|P39205|CIN_DROME Molybdenum cofactor synthesis protein cinnamon OS=Drosophila melanogaster GN=cin PE=1 SV=3 1 517 2.0E-64
sp|O31703|MOEA_BACSU Molybdopterin molybdenumtransferase OS=Bacillus subtilis (strain 168) GN=moeA PE=3 SV=1 104 533 3.0E-52
sp|P45210|MOEA_HAEIN Molybdopterin molybdenumtransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeA PE=3 SV=1 111 528 5.0E-51
sp|Q56066|MOEA_SALTY Molybdopterin molybdenumtransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moeA PE=3 SV=2 111 529 8.0E-48
sp|Q44243|MOEA_NOSS1 Molybdopterin molybdenumtransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moeA PE=3 SV=1 92 525 9.0E-48
sp|P12281|MOEA_ECOLI Molybdopterin molybdenumtransferase OS=Escherichia coli (strain K12) GN=moeA PE=1 SV=1 111 515 2.0E-47
sp|Q8CNE1|MOEA_STAES Molybdopterin molybdenumtransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moeA PE=3 SV=1 112 532 1.0E-40
sp|Q5HLX6|MOEA_STAEQ Molybdopterin molybdenumtransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moeA PE=3 SV=1 112 532 1.0E-40
sp|Q8NVA1|MOEA_STAAW Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain MW2) GN=moeA PE=3 SV=1 137 532 2.0E-38
sp|Q6G749|MOEA_STAAS Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain MSSA476) GN=moeA PE=3 SV=1 137 532 2.0E-38
sp|Q5HDT4|MOEA_STAAC Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain COL) GN=moeA PE=3 SV=1 137 532 3.0E-38
sp|P99139|MOEA_STAAN Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain N315) GN=moeA PE=1 SV=1 137 532 3.0E-38
sp|P65407|MOEA_STAAM Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=moeA PE=3 SV=1 137 532 3.0E-38
sp|Q6GEG1|MOEA_STAAR Molybdopterin molybdenumtransferase OS=Staphylococcus aureus (strain MRSA252) GN=moeA PE=3 SV=1 137 532 3.0E-38
sp|Q56207|MOEA_SYNE7 Molybdopterin molybdenumtransferase OS=Synechococcus elongatus (strain PCC 7942) GN=moeA PE=3 SV=1 143 529 2.0E-31
sp|Q58296|Y886_METJA Putative molybdopterin biosynthesis protein MJ0886 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0886 PE=3 SV=1 140 536 3.0E-29
sp|Q58080|Y666_METJA Putative molybdopterin biosynthesis protein MJ0666 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0666 PE=3 SV=1 140 443 1.0E-28
sp|Q55368|MOEA_SYNY3 Molybdopterin molybdenumtransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=moeA PE=3 SV=1 111 444 2.0E-25
sp|P9WJQ5|MOEA2_MYCTU Molybdopterin molybdenumtransferase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaE2 PE=1 SV=1 141 528 7.0E-25
sp|P9WJQ4|MOEA2_MYCTO Molybdopterin molybdenumtransferase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaE2 PE=3 SV=1 141 528 7.0E-25
sp|P9WJQ7|MOEA1_MYCTU Molybdopterin molybdenumtransferase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeA1 PE=1 SV=1 111 537 2.0E-20
sp|P9WJQ6|MOEA1_MYCTO Molybdopterin molybdenumtransferase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeA1 PE=3 SV=1 111 537 2.0E-20
sp|B8I7D0|CINA_CLOCE Putative competence-damage inducible protein OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=cinA PE=3 SV=1 300 454 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0032324 molybdopterin cofactor biosynthetic process Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0043545 molybdopterin cofactor metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0051189 prosthetic group metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4456
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|137 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4221
Ophiocordyceps camponoti-floridani Ophcf2|04188
Ophiocordyceps camponoti-rufipedis Ophun1|3847
Ophiocordyceps kimflemingae Ophio5|1200
Ophiocordyceps subramaniannii Hirsu2|9252

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|137
MSRPVAGVRHRSVIITLPGSPKGAKENLVSIVKMLPHACVQASGGDSRALHSGGVDKLEKKAGIASSSSHSHCQH
GHATLVRHSLPEGKRPLSNDASQGPTQRHRTSPYPMLSVEDALGLIAQFTPDPVETSCRVDEHLVGSVVAQEVTA
TENVPAFRASTVDGYAVVTSGNASDSFAGVFPVVAVSHAAPGQAKPLEKGHVARITTGAPLPPGATAVVMVENTA
IASTTDDGKEELAVDIQAQGVCAGDNVREVGSDIALGALLLAKGERISGVGGEIGLVAAVGCASLRVYKRPVIGV
LSTGDELVEHDERGPLKLGQVRDTNRPTLVSAAAERGFRVVDLGIVGDKPGALEETLRKGLRQVDVLITTGGVSM
GELDLLKPTVERALGGTIHFGRVAMKPGKPTTFATVQVKDASGTRVVKPVFSLPGNPASALVTFYLFVLPALHKM
SGQSPVSLPKVPVVLAHDFSMDDRPEYHRAVVAVGHDGRLVATSTGGQRSSRVASLRAANALVCVPAGKAKVAKG
TSLDALLIGTIGAIV*
Coding >OphauG2|137
ATGTCTCGCCCCGTTGCTGGCGTCCGGCACAGGTCCGTCATCATCACCCTGCCCGGCTCGCCAAAGGGCGCCAAG
GAGAATCTCGTCTCCATTGTCAAGATGCTGCCCCATGCTTGCGTCCAGGCTTCGGGCGGCGACTCGCGCGCTTTG
CATTCGGGCGGCGTCGACAAGCTTGAAAAGAAGGCTGGGATAGCCTCGTCGTCGTCGCACAGCCATTGCCAGCAT
GGGCACGCAACGCTCGTTCGACACTCGCTGCCCGAGGGGAAACGGCCTCTTTCAAATGATGCCAGCCAGGGCCCT
ACACAGCGCCATCGCACCTCGCCCTATCCCATGCTTTCCGTTGAGGATGCCCTCGGTCTTATTGCCCAGTTTACT
CCCGACCCGGTCGAAACGAGCTGCAGAGTCGACGAGCATCTTGTCGGCTCGGTTGTTGCCCAGGAGGTCACGGCG
ACGGAAAACGTGCCCGCCTTTCGAGCAAGCACCGTTGACGGATACGCCGTCGTCACGAGCGGCAATGCCTCCGAC
TCCTTTGCCGGCGTCTTCCCCGTCGTTGCCGTTTCTCACGCCGCTCCCGGCCAGGCAAAGCCGCTTGAAAAGGGC
CACGTTGCCCGAATCACCACGGGCGCTCCCCTGCCGCCTGGCGCCACCGCTGTCGTCATGGTGGAAAACACGGCC
ATCGCGTCGACAACTGACGACGGCAAGGAGGAGCTGGCGGTGGACATCCAAGCCCAAGGCGTCTGCGCCGGCGAT
AACGTCCGCGAGGTGGGAAGCGACATTGCCCTCGGCGCCCTCCTTCTGGCCAAGGGCGAGCGCATCTCGGGCGTC
GGCGGCGAAATCGGCCTCGTCGCCGCCGTTGGATGCGCCAGTCTCAGAGTCTACAAGCGGCCCGTCATTGGCGTC
TTGTCCACGGGCGACGAACTCGTGGAGCACGACGAGCGCGGCCCGCTCAAGCTCGGCCAGGTCCGCGACACGAAC
CGTCCGACCCTCGTCTCGGCGGCCGCTGAGCGCGGCTTCCGCGTCGTCGACCTGGGCATCGTCGGCGACAAGCCC
GGCGCTCTCGAGGAGACGCTGCGCAAGGGCCTGCGCCAAGTCGACGTCCTCATCACCACTGGCGGCGTCTCCATG
GGCGAGCTGGACCTGCTCAAGCCCACGGTGGAGCGTGCCCTGGGCGGCACCATTCATTTTGGCCGCGTCGCCATG
AAACCCGGCAAGCCAACCACCTTTGCCACGGTGCAGGTCAAGGACGCCTCGGGCACCCGTGTCGTCAAGCCCGTC
TTTTCCCTGCCCGGCAATCCCGCCTCGGCCCTGGTTACCTTTTATCTCTTTGTTCTTCCTGCCCTGCACAAAATG
TCTGGCCAGTCGCCCGTCAGCCTGCCCAAGGTTCCCGTGGTCCTCGCCCACGACTTTTCCATGGATGACCGGCCC
GAGTATCATCGTGCCGTCGTTGCTGTGGGACACGACGGCCGCCTCGTCGCCACCAGCACCGGCGGCCAACGTAGC
TCCAGGGTCGCCAGTCTGCGCGCTGCAAACGCCCTGGTATGCGTGCCAGCCGGCAAGGCCAAGGTGGCCAAGGGG
ACCAGTCTCGATGCCTTGCTGATTGGTACCATTGGGGCCATAGTATAA
Transcript >OphauG2|137
ATGTCTCGCCCCGTTGCTGGCGTCCGGCACAGGTCCGTCATCATCACCCTGCCCGGCTCGCCAAAGGGCGCCAAG
GAGAATCTCGTCTCCATTGTCAAGATGCTGCCCCATGCTTGCGTCCAGGCTTCGGGCGGCGACTCGCGCGCTTTG
CATTCGGGCGGCGTCGACAAGCTTGAAAAGAAGGCTGGGATAGCCTCGTCGTCGTCGCACAGCCATTGCCAGCAT
GGGCACGCAACGCTCGTTCGACACTCGCTGCCCGAGGGGAAACGGCCTCTTTCAAATGATGCCAGCCAGGGCCCT
ACACAGCGCCATCGCACCTCGCCCTATCCCATGCTTTCCGTTGAGGATGCCCTCGGTCTTATTGCCCAGTTTACT
CCCGACCCGGTCGAAACGAGCTGCAGAGTCGACGAGCATCTTGTCGGCTCGGTTGTTGCCCAGGAGGTCACGGCG
ACGGAAAACGTGCCCGCCTTTCGAGCAAGCACCGTTGACGGATACGCCGTCGTCACGAGCGGCAATGCCTCCGAC
TCCTTTGCCGGCGTCTTCCCCGTCGTTGCCGTTTCTCACGCCGCTCCCGGCCAGGCAAAGCCGCTTGAAAAGGGC
CACGTTGCCCGAATCACCACGGGCGCTCCCCTGCCGCCTGGCGCCACCGCTGTCGTCATGGTGGAAAACACGGCC
ATCGCGTCGACAACTGACGACGGCAAGGAGGAGCTGGCGGTGGACATCCAAGCCCAAGGCGTCTGCGCCGGCGAT
AACGTCCGCGAGGTGGGAAGCGACATTGCCCTCGGCGCCCTCCTTCTGGCCAAGGGCGAGCGCATCTCGGGCGTC
GGCGGCGAAATCGGCCTCGTCGCCGCCGTTGGATGCGCCAGTCTCAGAGTCTACAAGCGGCCCGTCATTGGCGTC
TTGTCCACGGGCGACGAACTCGTGGAGCACGACGAGCGCGGCCCGCTCAAGCTCGGCCAGGTCCGCGACACGAAC
CGTCCGACCCTCGTCTCGGCGGCCGCTGAGCGCGGCTTCCGCGTCGTCGACCTGGGCATCGTCGGCGACAAGCCC
GGCGCTCTCGAGGAGACGCTGCGCAAGGGCCTGCGCCAAGTCGACGTCCTCATCACCACTGGCGGCGTCTCCATG
GGCGAGCTGGACCTGCTCAAGCCCACGGTGGAGCGTGCCCTGGGCGGCACCATTCATTTTGGCCGCGTCGCCATG
AAACCCGGCAAGCCAACCACCTTTGCCACGGTGCAGGTCAAGGACGCCTCGGGCACCCGTGTCGTCAAGCCCGTC
TTTTCCCTGCCCGGCAATCCCGCCTCGGCCCTGGTTACCTTTTATCTCTTTGTTCTTCCTGCCCTGCACAAAATG
TCTGGCCAGTCGCCCGTCAGCCTGCCCAAGGTTCCCGTGGTCCTCGCCCACGACTTTTCCATGGATGACCGGCCC
GAGTATCATCGTGCCGTCGTTGCTGTGGGACACGACGGCCGCCTCGTCGCCACCAGCACCGGCGGCCAACGTAGC
TCCAGGGTCGCCAGTCTGCGCGCTGCAAACGCCCTGGTATGCGTGCCAGCCGGCAAGGCCAAGGTGGCCAAGGGG
ACCAGTCTCGATGCCTTGCTGATTGGTACCATTGGGGCCATAGTATAA
Gene >OphauG2|137
ATGTCTCGCCCCGTTGCTGGCGTCCGGCACAGGTCCGTCATCATCACCCTGCCCGGCTCGCCAAAGGGCGCCAAG
GAGAATCTCGTCTCCATTGTCAAGATGCTGCCCCATGCTTGCGTCCAGGCTTCGGGCGGCGACTCGCGCGCTTTG
CATTCGGGCGGCGTCGACAAGCTTGAAAAGAAGGCTGGGATAGCCTCGTCGTCGTCGCACAGCCATTGCCAGCAT
GGGCACGCAACGCTCGTTCGACACTCGCTGCCCGAGGGGAAACGGCCTCTTTCAAATGATGCCAGCCAGGGCCCT
ACACAGCGCCATCGCACCTCGCCCTATCCCATGCTTTCCGTTGAGGATGCCCTCGGTCTTATTGCCCAGTTTACT
CCCGACCCGGTCGAAACGAGCTGCAGAGTCGACGAGCATCTTGTCGGCTCGGTTGTTGCCCAGGAGGTCACGGCG
ACGGAAAACGTGCCCGCCTTTCGAGCAAGCACCGTTGACGGATACGCCGTCGTCACGAGCGGCAATGCCTCCGAC
TCCTTTGCCGGCGTCTTCCCCGTCGTTGCCGTTTCTCACGCCGCTCCCGGCCAGGCAAAGCCGCTTGAAAAGGGC
CACGTTGCCCGAATCACCACGGGCGCTCCCCTGCCGCCTGGCGCCACCGCTGTCGTCATGGTGGAAAACACGGCC
ATCGCGTCGACAACTGACGACGGCAAGGAGGAGCTGGCGGTGGACATCCAAGCCCAAGGCGTCTGCGCCGGCGAT
AACGTCCGCGAGGTGGGAAGCGACATTGCCCTCGGCGCCCTCCTTCTGGCCAAGGGCGAGCGCATCTCGGGCGTC
GGCGGCGAAATCGGCCTCGTCGCCGCCGTTGGATGCGCCAGTCTCAGAGTCTACAAGCGGCCCGTCATTGGCGTC
TTGTCCACGGGCGACGAACTCGTGGAGCACGACGAGCGCGGCCCGCTCAAGCTCGGCCAGGTCCGCGACACGAAC
CGTCCGACCCTCGTCTCGGCGGCCGCTGAGCGCGGCTTCCGCGTCGTCGACCTGGGCATCGTCGGCGACAAGCCC
GGCGCTCTCGAGGAGACGCTGCGCAAGGGCCTGCGCCAAGTCGACGTCCTCATCACCACTGGCGGCGTCTCCATG
GGCGAGCTGGACCTGCTCAAGCCCACGGTGGAGCGTGCCCTGGGCGGCACCATTCATTTTGGCCGCGTCGCCATG
AAACCCGGCAAGCCAACCACCTTTGCCACGGTGCAGGTCAAGGACGCCTCGGGCACCCGTGTCGTCAAGCCCGTC
TTTTCCCTGCCCGGCAATCCCGCCTCGGCCCTGGTTACCTTTTATCTCTTTGTTCTTCCTGCCCTGCACAAAATG
TCTGGCCAGTCGCCCGTCAGCCTGCCCAAGGTTCCCGTGGTCCTCGCCCACGACTTTTCCATGGATGACCGGCCC
GAGTATCATCGTGCCGTCGTTGCTGTGGGACACGACGGCCGCCTCGTCGCCACCAGCACCGGCGGCCAACGTAGC
TCCAGGGTCGCCAGTCTGCGCGCTGCAAACGCCCTGGTATGCGTGCCAGCCGGCAAGGCCAAGGTGGCCAAGGGG
ACCAGTCTCGATGCCTTGCTGATTGGTACCATTGGGGCCATAGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail