Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1352
Gene name
LocationContig_14:49669..55674
Strand+
Gene length (bp)6005
Transcript length (bp)5949
Coding sequence length (bp)5949
Protein length (aa) 1983

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12931 Sec16_C Sec23-binding domain of Sec16 5.5E-109 1191 1493
PF12932 Sec16 Vesicle coat trafficking protein Sec16 mid-region 2.9E-30 1012 1130
PF12935 Sec16_N Vesicle coat trafficking protein Sec16 N-terminus 1.0E-08 313 480

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DLN3|SEC16_NEOFI COPII coat assembly protein sec16 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec16 PE=3 SV=1 301 1982 0.0E+00
sp|Q2GXM1|SEC16_CHAGB COPII coat assembly protein SEC16 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC16 PE=3 SV=1 182 1868 0.0E+00
sp|A2R4T4|SEC16_ASPNC COPII coat assembly protein sec16 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec16 PE=3 SV=2 737 1982 0.0E+00
sp|A1CME3|SEC16_ASPCL COPII coat assembly protein sec16 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec16 PE=3 SV=1 735 1982 0.0E+00
sp|Q0CGY7|SEC16_ASPTN COPII coat assembly protein sec16 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec16 PE=3 SV=1 318 1982 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DLN3|SEC16_NEOFI COPII coat assembly protein sec16 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec16 PE=3 SV=1 301 1982 0.0E+00
sp|Q2GXM1|SEC16_CHAGB COPII coat assembly protein SEC16 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC16 PE=3 SV=1 182 1868 0.0E+00
sp|A2R4T4|SEC16_ASPNC COPII coat assembly protein sec16 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec16 PE=3 SV=2 737 1982 0.0E+00
sp|A1CME3|SEC16_ASPCL COPII coat assembly protein sec16 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec16 PE=3 SV=1 735 1982 0.0E+00
sp|Q0CGY7|SEC16_ASPTN COPII coat assembly protein sec16 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec16 PE=3 SV=1 318 1982 0.0E+00
sp|Q2U968|SEC16_ASPOR COPII coat assembly protein sec16 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec16 PE=3 SV=1 927 1982 0.0E+00
sp|Q1DHP3|SEC16_COCIM COPII coat assembly protein SEC16 OS=Coccidioides immitis (strain RS) GN=SEC16 PE=3 SV=1 258 1982 0.0E+00
sp|Q4WD95|SEC16_ASPFU COPII coat assembly protein sec16 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec16 PE=3 SV=1 301 1982 0.0E+00
sp|Q5AYL5|SEC16_EMENI COPII coat assembly protein sec16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec16 PE=3 SV=1 989 1979 2.0E-168
sp|Q0V3R6|SEC16_PHANO COPII coat assembly protein SEC16 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC16 PE=3 SV=2 490 1533 1.0E-158
sp|Q6CEV2|SEC16_YARLI COPII coat assembly protein SEC16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC16 PE=3 SV=1 1050 1539 5.0E-47
sp|A5DH19|SEC16_PICGU COPII coat assembly protein SEC16 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC16 PE=3 SV=2 956 1592 2.0E-36
sp|Q6BXI1|SEC16_DEBHA COPII coat assembly protein SEC16 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC16 PE=3 SV=2 1045 1562 1.0E-35
sp|A3LZ57|SEC16_PICST COPII coat assembly protein SEC16 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC16 PE=3 SV=2 1010 1732 4.0E-31
sp|O14029|SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec16 PE=1 SV=2 1013 1626 1.0E-26
sp|Q0V3R6|SEC16_PHANO COPII coat assembly protein SEC16 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC16 PE=3 SV=2 1709 1980 2.0E-24
sp|Q96JE7|SC16B_HUMAN Protein transport protein Sec16B OS=Homo sapiens GN=SEC16B PE=1 SV=2 1187 1459 7.0E-24
sp|O15027|SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens GN=SEC16A PE=1 SV=3 1017 1470 3.0E-23
sp|Q6BCB4|SC16B_RABIT Protein transport protein Sec16B OS=Oryctolagus cuniculus GN=SEC16B PE=2 SV=1 1186 1461 5.0E-23
sp|Q75N33|SC16B_RAT Protein transport protein Sec16B OS=Rattus norvegicus GN=Sec16b PE=1 SV=1 1187 1459 1.0E-22
sp|Q91XT4|SC16B_MOUSE Protein transport protein Sec16B OS=Mus musculus GN=Sec16b PE=1 SV=3 1187 1459 9.0E-22
sp|Q75NY9|SC16B_BOVIN Protein transport protein Sec16B OS=Bos taurus GN=SEC16B PE=2 SV=1 1187 1459 1.0E-20
sp|Q74ZJ8|SEC16_ASHGO COPII coat assembly protein SEC16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC16 PE=3 SV=1 933 1493 5.0E-20
sp|Q6AW68|SC16B_CHICK Protein transport protein Sec16B OS=Gallus gallus GN=SEC16B PE=2 SV=1 1015 1457 5.0E-18
sp|Q9FGK8|SC16B_ARATH Protein transport protein SEC16B homolog OS=Arabidopsis thaliana GN=SEC16B PE=1 SV=1 961 1441 1.0E-13
sp|Q9FGK9|MAG5_ARATH Protein transport protein SEC16A homolog OS=Arabidopsis thaliana GN=MAG5 PE=1 SV=1 1018 1483 1.0E-11
sp|P48415|SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC16 PE=1 SV=2 1010 1494 7.0E-11
sp|Q6FRV6|SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC16 PE=3 SV=1 915 1494 2.0E-10
sp|Q6CM10|SEC16_KLULA COPII coat assembly protein SEC16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC16 PE=3 SV=1 1768 1980 1.0E-08
sp|P48415|SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC16 PE=1 SV=2 1555 1980 2.0E-07
sp|Q6FRV6|SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC16 PE=3 SV=1 1791 1980 2.0E-07
sp|Q74ZJ8|SEC16_ASHGO COPII coat assembly protein SEC16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC16 PE=3 SV=1 1799 1980 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1352 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6027
Ophiocordyceps australis map64 (Brazil) OphauB2|6111
Ophiocordyceps camponoti-floridani Ophcf2|05367
Ophiocordyceps camponoti-rufipedis Ophun1|4317
Ophiocordyceps kimflemingae Ophio5|8260
Ophiocordyceps subramaniannii Hirsu2|1418

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1352
MASRPPGSSWNPALMPGSDISPDLDYTTSEREPVESAIPAPEPPVHVEELNHSPQDAPSSASPDPFLSNAVVNQA
EEQEPIVQNSPNQDHQFQPLDEQVNVDAQTTHSYEQDEFNGASGADPEAVEALFEQSAAHPSAEEHNQDGELATM
SSTTLEDDRTGSNASKTVSNTADIETEWGMEGTEKIADDGIPSHPETTGIAHGQHSSSLSFARTVSHQVSFIDEE
ETDWTLPHPGPDVSTFLPPSAERSNFFPPVPPVQSTDSKSEHQPLPSTQASDILGTISNYDDAESQDLAPDTQQE
GFWQSIGGEVQSFEAQASEARYEEGIPLISHESEVMEQEPMEQESMESGDGDLGDPFAGDGENEDDFFSQMHQPA
QPQTEERREPLERKSTMQVIGTTTPEPVSRQNTLGSTVEEQDEDPGVQSQQNDDAANNDYLSALKDEQGHAEALP
SEDIESKWQQAFAGDDEDEFLFDEPATEHQDVDPAAFLGSDDEGLLDDDADEAVPEPQPVPPAPANQHASVPSRY
TPVSLPAQQTSSPYVPQGTTPTQPSVIQQGPFSSALYAPSQYGQAPAPRPQPSSTQSFVDKAKGGYSSPYDLPSD
LMPTTVQPRKRASMIQLPNEPTAHPPRSTNMYSPAQNAPFSAAPAQAPVAAPVPAPAPGATAQRPPPTHTSSTPT
MHSQSSFFQELPVSSKPRQGAKTAGPQSPAVASPPPQSNYALPGAPHQTSVSPYAAVGNLVQPERVSPYAPLQHP
SSGPAPMQAPGPAPPGNTRYSSAPAQAQLQQTAPAPTSSRYSPVPAGPRPGSSSGPASNPPQPALPHLPRTSSPL
AQFETSINNPDRRSSASFEPRLSRVASLPPTHEVDEDEENGASQAYPVSNNASRFSPASVPSVARQTPPLVSSKP
GPPAPSPPKRSTTNYAPQAAPATQPGFVPPPRPSTQSPGTTRSNQGYRPSDHGARPSSAHSMAPRTHHVPMSQQV
YGASAGARSNPLSTHSANLVPPTDGREHDPLQRWKGVPLIAWGVGGTVITSFPKSSPRYSVAQTAPVVLRTPGEV
RVQNIREIDALSEQHVKFPGPLKGKSKKKEALAWLSAGIDAQEKEIPDVTFHSQLSLEAKRGVERLLLWRLLRIF
IEFDGALEGSSAVEQAVRGVLSPAVTSPMAENDGLYYAAATFAPKTGSTNVAYADAADGSAVEKMRNSLLRGDRE
SAVWAAVDKRLWGHAMLISHTVSPDLYKRVAQEFVRKEVNYPGHSNESMAALYKVLSGNFDDCVDELVPIHARAG
LQLVSKEASSGSTKDVMDGLDKWRETLTLILSNRSTDDVRGLNALGKLLASYGRAEAAQICFIFSRTQSVFGGLD
DGDADFVLVGSDHRQQPDGFFKETEALQLSEMYEYGLSLAGGAAASAGAPHLAGYKLQHAITLAEYGYRDKALQY
CDSISAAIVSQTRRSPYHHVVLQAAVDDFSKRLKQAPKDGSSSWMSKPSMGKVSDSMWNRFNKFVAGDEGGEGSA
GGMHDAGNGPFARIAATPSMSRSPSASNFDNFSTTSPIYGASAPVSASAHAPVMTSRYAPASGQAAVAPNPYAPV
SEYAPGPAASYAPAQYPAAAASLGPSINDVPRNSYAPTHPGTSQSPAVGHGGYVPPTYSPQASGYHPVSQVVSPA
VTAQHHAHQPPHSRDFQPSALQASPIIYPMDNSMVAGTSMENMPSSVAAANDQGYAKETTSSHGGYVPPSYQPYG
YEPPSYQPEPETTSDETQDGPQAKKKSFMDDDDHLPALRPQGNSKPDQNREHDELFRKAVEEDEKRAAAQQANKK
GWGFTGWFKGAKKNEANIGEATANKPIRAKLGDESSFVYDPDLKRWVNKKPGAENTEAKKSTPPPPKAVLRSASS
TLAPSVSEMMSSGGRASAPPRAPPPHASEESAQKPPDLNVGAGTPSMSRQASSSGPMAHLASEPPSRPGTSMSNA
SSIDDLLGAAGPRKSGPKKPRKSGRYVDVMAK*
Coding >OphauG2|1352
ATGGCCTCCCGGCCACCCGGATCCTCGTGGAATCCGGCCTTGATGCCAGGCTCCGACATCAGCCCTGACCTTGAC
TATACAACTTCAGAGCGCGAGCCAGTTGAATCCGCGATCCCAGCCCCCGAGCCTCCAGTCCATGTTGAAGAACTC
AACCACTCCCCCCAAGACGCTCCATCTAGCGCCTCACCCGACCCCTTTCTGTCCAACGCTGTCGTGAATCAGGCT
GAAGAACAAGAGCCTATCGTTCAAAACTCTCCAAATCAAGACCATCAATTTCAACCCTTGGATGAACAGGTCAAT
GTTGATGCCCAAACAACGCATAGCTATGAACAAGACGAGTTCAATGGTGCAAGTGGTGCAGACCCAGAGGCTGTT
GAAGCTCTCTTTGAACAAAGCGCAGCTCATCCTTCAGCCGAGGAGCATAATCAAGATGGCGAGCTTGCTACCATG
AGTAGTACGACCCTCGAAGATGATCGAACCGGGAGCAATGCTTCAAAGACTGTCTCGAACACTGCAGATATTGAG
ACTGAATGGGGAATGGAGGGCACCGAGAAGATAGCCGACGATGGAATCCCTAGTCACCCTGAAACTACCGGGATA
GCACATGGGCAGCATTCCAGCTCTCTGTCGTTTGCTCGAACCGTCTCCCACCAAGTCAGCTTCATTGACGAAGAA
GAGACAGATTGGACTTTGCCACACCCTGGACCCGACGTCTCAACCTTCTTGCCGCCATCGGCTGAGAGAAGCAAT
TTTTTTCCACCCGTGCCCCCGGTGCAGTCCACAGATTCAAAATCGGAACATCAGCCTCTGCCAAGCACGCAAGCG
TCAGATATCTTGGGCACGATTTCGAATTATGACGACGCCGAGTCGCAAGATCTCGCCCCAGACACCCAACAAGAA
GGTTTCTGGCAATCTATTGGTGGCGAGGTCCAGAGTTTCGAAGCACAGGCGTCGGAAGCGCGTTATGAAGAAGGC
ATTCCTTTGATTTCGCATGAGTCGGAAGTAATGGAGCAGGAACCCATGGAGCAGGAATCCATGGAAAGCGGCGAC
GGAGACCTCGGCGATCCTTTTGCTGGGGATGGTGAAAACGAAGACGACTTCTTCTCCCAAATGCATCAGCCTGCC
CAGCCACAGACAGAGGAGCGTCGCGAGCCCCTTGAGCGCAAGTCTACCATGCAGGTCATTGGGACAACGACCCCA
GAGCCAGTCTCAAGACAGAACACCTTGGGATCTACTGTCGAGGAACAAGACGAGGACCCTGGGGTCCAGAGTCAG
CAAAACGACGACGCGGCTAACAATGACTATTTGTCAGCATTGAAAGACGAACAAGGTCATGCCGAGGCTCTCCCC
TCTGAAGACATTGAATCCAAATGGCAACAAGCTTTTGCGGGGGACGATGAGGATGAGTTCCTGTTTGACGAGCCA
GCAACTGAACATCAAGATGTGGATCCAGCTGCATTCCTCGGAAGCGATGATGAAGGCCTCCTGGATGACGATGCC
GACGAAGCAGTGCCCGAGCCTCAGCCTGTACCACCTGCCCCTGCCAACCAACATGCATCTGTCCCAAGCCGGTAT
ACTCCGGTCAGCCTTCCGGCGCAGCAAACATCGAGCCCATATGTGCCTCAGGGGACCACACCTACACAGCCCAGC
GTGATACAACAAGGCCCATTTTCGTCGGCTTTGTATGCCCCATCGCAATATGGCCAAGCGCCAGCGCCTCGGCCC
CAGCCCTCAAGCACGCAAAGCTTCGTGGACAAGGCAAAAGGCGGCTACTCTTCTCCCTATGATCTGCCTTCGGAC
CTGATGCCAACTACAGTACAACCTCGAAAAAGGGCCAGCATGATACAGCTGCCCAACGAGCCTACGGCCCATCCT
CCAAGGAGTACAAACATGTATTCTCCAGCCCAAAATGCCCCGTTTAGTGCGGCTCCTGCTCAAGCTCCAGTTGCG
GCTCCGGTTCCAGCTCCAGCTCCGGGCGCGACCGCACAACGACCACCGCCCACTCACACATCTTCAACTCCAACG
ATGCACAGCCAGAGCAGCTTCTTCCAAGAGCTTCCTGTGTCGTCGAAGCCGCGGCAAGGCGCAAAAACGGCAGGG
CCTCAATCGCCGGCCGTTGCTAGTCCACCACCGCAGTCGAATTATGCGTTGCCTGGTGCACCTCACCAAACCTCT
GTCTCGCCATACGCCGCAGTGGGCAATCTTGTGCAGCCCGAGCGAGTGAGCCCTTATGCGCCGCTTCAGCACCCG
TCATCAGGCCCAGCCCCTATGCAAGCTCCCGGTCCTGCGCCACCAGGCAACACGAGATATTCATCGGCTCCAGCA
CAAGCCCAACTCCAACAGACGGCCCCGGCGCCCACTTCCAGCCGATACTCTCCGGTACCTGCAGGCCCTCGGCCC
GGCAGCTCATCGGGCCCGGCCTCAAATCCGCCACAGCCTGCTCTGCCGCATCTCCCTCGGACGTCGAGCCCTCTT
GCACAATTCGAGACGAGCATCAACAACCCTGATCGTCGGTCTAGCGCCTCATTTGAGCCTCGCTTGAGCCGTGTA
GCCTCGCTCCCTCCGACTCACGAAGTGGACGAAGACGAGGAAAACGGAGCCAGCCAAGCGTATCCCGTCTCCAAC
AACGCCTCCAGGTTTAGCCCAGCGTCTGTCCCATCAGTGGCCCGTCAAACCCCTCCCCTGGTTTCGAGTAAGCCT
GGTCCTCCAGCTCCATCGCCCCCGAAAAGAAGCACCACAAACTATGCCCCCCAGGCTGCTCCTGCTACCCAACCT
GGATTCGTTCCCCCGCCTCGACCATCGACTCAATCTCCCGGCACTACGCGTAGTAATCAGGGCTATAGGCCATCC
GACCATGGGGCCCGGCCTTCATCCGCCCATTCCATGGCACCACGGACTCATCACGTGCCAATGTCTCAGCAAGTC
TATGGAGCGAGTGCCGGCGCTCGCTCAAACCCGCTCTCCACTCACTCGGCCAACCTGGTGCCACCGACGGATGGA
AGGGAGCATGATCCCCTGCAACGGTGGAAGGGAGTGCCTTTGATTGCTTGGGGAGTGGGAGGCACTGTCATTACC
TCGTTCCCAAAAAGCTCGCCGCGGTACTCGGTAGCTCAGACAGCACCAGTCGTCTTGCGAACACCGGGTGAAGTC
AGGGTACAGAACATTCGGGAGATTGATGCGCTCTCGGAGCAGCACGTCAAGTTTCCAGGCCCCTTGAAGGGCAAA
TCGAAAAAGAAGGAGGCGCTCGCTTGGCTGTCTGCGGGCATTGATGCTCAGGAAAAAGAAATACCAGACGTGACA
TTTCACTCCCAGTTGTCGCTCGAGGCGAAGCGCGGCGTTGAACGTCTGCTCCTATGGAGGCTTCTCCGCATATTC
ATCGAGTTTGACGGAGCTTTGGAGGGCAGCAGTGCAGTTGAACAGGCTGTGCGAGGCGTGCTGTCTCCAGCCGTG
ACATCTCCCATGGCAGAAAACGACGGGCTGTATTATGCAGCTGCCACCTTTGCCCCCAAAACTGGCTCGACCAAC
GTGGCTTATGCAGACGCGGCAGATGGGTCGGCCGTGGAAAAGATGCGCAACAGTCTTCTCAGGGGCGATCGCGAG
AGCGCCGTCTGGGCTGCAGTAGACAAGCGTCTGTGGGGCCACGCCATGTTGATTTCGCACACGGTGTCTCCCGAT
CTATACAAGCGCGTGGCCCAGGAGTTTGTGCGCAAAGAAGTCAACTATCCGGGCCACAGCAACGAGTCTATGGCG
GCTCTGTACAAAGTCTTGTCTGGAAACTTTGACGACTGCGTCGACGAGCTGGTGCCAATCCATGCTCGGGCTGGC
CTTCAACTCGTGTCCAAAGAAGCTTCATCGGGCTCCACCAAGGACGTCATGGACGGGCTCGATAAGTGGCGAGAA
ACGCTGACGCTGATACTGAGCAACCGCAGCACCGACGATGTTCGAGGTCTGAATGCCCTGGGCAAGCTCTTGGCA
AGCTACGGCAGGGCGGAAGCTGCGCAGATATGCTTCATATTTAGCAGGACCCAGTCAGTCTTTGGCGGGCTGGAC
GACGGCGATGCTGACTTTGTCCTTGTTGGATCCGATCACCGGCAACAGCCCGACGGCTTCTTCAAGGAAACAGAA
GCGCTACAGCTCAGCGAGATGTATGAGTACGGCCTATCTCTTGCTGGAGGAGCTGCTGCCTCTGCCGGCGCTCCT
CATCTGGCAGGATACAAGCTGCAGCACGCCATTACGCTGGCCGAGTATGGGTACCGAGACAAGGCTCTTCAGTAC
TGCGATTCTATTTCTGCAGCCATCGTCTCACAGACGCGGCGATCTCCCTACCATCACGTGGTGCTCCAGGCGGCT
GTTGATGACTTTTCCAAGAGACTCAAGCAAGCTCCCAAGGACGGCTCCTCGTCGTGGATGTCCAAACCCAGCATG
GGCAAGGTGTCAGACAGCATGTGGAACCGCTTCAACAAGTTTGTGGCTGGCGACGAAGGCGGGGAGGGCTCTGCT
GGAGGCATGCATGACGCCGGCAACGGGCCATTTGCTCGGATTGCTGCAACACCCAGCATGAGTCGCTCGCCATCC
GCCTCCAACTTTGACAACTTTTCAACCACGTCGCCCATATATGGAGCTTCAGCACCCGTATCCGCCTCGGCCCAC
GCACCCGTCATGACGTCTCGATACGCTCCGGCCTCTGGACAGGCTGCTGTCGCGCCAAACCCATATGCGCCCGTG
TCAGAATATGCTCCAGGGCCTGCCGCTTCGTATGCGCCAGCGCAATACCCTGCAGCTGCCGCGTCGTTGGGGCCA
TCTATCAATGACGTGCCTCGCAATTCCTACGCACCTACGCATCCAGGGACTAGCCAGTCCCCTGCCGTGGGCCAT
GGCGGTTATGTGCCTCCAACATATTCTCCACAAGCCTCTGGATACCACCCAGTTTCACAGGTAGTTTCCCCTGCC
GTAACTGCTCAACATCACGCGCATCAGCCCCCACATTCCAGAGACTTCCAGCCGAGTGCTCTTCAAGCGAGTCCA
ATCATTTATCCCATGGACAACAGCATGGTAGCTGGCACATCTATGGAAAACATGCCGAGCAGCGTGGCAGCTGCC
AACGATCAAGGCTATGCGAAAGAAACTACGAGCAGTCATGGCGGCTATGTGCCTCCCTCGTATCAGCCCTACGGG
TACGAGCCACCATCGTATCAGCCTGAACCGGAGACTACTTCAGATGAAACCCAAGATGGGCCCCAAGCCAAAAAG
AAGAGTTTTATGGATGATGACGACCATTTGCCTGCCCTGAGGCCTCAAGGCAATTCCAAGCCCGACCAGAACCGT
GAGCACGACGAGTTGTTTCGCAAGGCAGTTGAAGAAGATGAGAAACGAGCCGCTGCACAGCAAGCCAACAAAAAA
GGATGGGGCTTCACGGGCTGGTTCAAAGGCGCTAAGAAGAACGAAGCCAATATTGGAGAGGCAACAGCTAACAAG
CCAATTCGCGCCAAACTTGGCGACGAGAGCAGCTTTGTCTACGACCCGGACCTCAAACGCTGGGTCAACAAAAAG
CCCGGTGCCGAAAATACCGAGGCCAAGAAGTCGACTCCGCCCCCGCCCAAGGCAGTACTTCGCAGTGCTAGTAGT
ACTTTAGCGCCCTCAGTATCGGAGATGATGTCCTCGGGCGGCCGTGCAAGTGCGCCTCCTCGGGCGCCTCCTCCG
CATGCATCTGAAGAGTCGGCCCAAAAGCCGCCAGATCTAAATGTTGGCGCTGGGACCCCAAGCATGAGCCGACAG
GCCTCATCGTCTGGCCCTATGGCACACTTGGCTAGCGAACCGCCCAGCCGACCTGGTACTAGCATGAGCAACGCC
AGCAGCATTGACGACTTACTAGGAGCGGCTGGGCCGCGCAAAAGCGGGCCCAAGAAACCCCGCAAAAGTGGGCGA
TATGTTGACGTTATGGCTAAGTAA
Transcript >OphauG2|1352
ATGGCCTCCCGGCCACCCGGATCCTCGTGGAATCCGGCCTTGATGCCAGGCTCCGACATCAGCCCTGACCTTGAC
TATACAACTTCAGAGCGCGAGCCAGTTGAATCCGCGATCCCAGCCCCCGAGCCTCCAGTCCATGTTGAAGAACTC
AACCACTCCCCCCAAGACGCTCCATCTAGCGCCTCACCCGACCCCTTTCTGTCCAACGCTGTCGTGAATCAGGCT
GAAGAACAAGAGCCTATCGTTCAAAACTCTCCAAATCAAGACCATCAATTTCAACCCTTGGATGAACAGGTCAAT
GTTGATGCCCAAACAACGCATAGCTATGAACAAGACGAGTTCAATGGTGCAAGTGGTGCAGACCCAGAGGCTGTT
GAAGCTCTCTTTGAACAAAGCGCAGCTCATCCTTCAGCCGAGGAGCATAATCAAGATGGCGAGCTTGCTACCATG
AGTAGTACGACCCTCGAAGATGATCGAACCGGGAGCAATGCTTCAAAGACTGTCTCGAACACTGCAGATATTGAG
ACTGAATGGGGAATGGAGGGCACCGAGAAGATAGCCGACGATGGAATCCCTAGTCACCCTGAAACTACCGGGATA
GCACATGGGCAGCATTCCAGCTCTCTGTCGTTTGCTCGAACCGTCTCCCACCAAGTCAGCTTCATTGACGAAGAA
GAGACAGATTGGACTTTGCCACACCCTGGACCCGACGTCTCAACCTTCTTGCCGCCATCGGCTGAGAGAAGCAAT
TTTTTTCCACCCGTGCCCCCGGTGCAGTCCACAGATTCAAAATCGGAACATCAGCCTCTGCCAAGCACGCAAGCG
TCAGATATCTTGGGCACGATTTCGAATTATGACGACGCCGAGTCGCAAGATCTCGCCCCAGACACCCAACAAGAA
GGTTTCTGGCAATCTATTGGTGGCGAGGTCCAGAGTTTCGAAGCACAGGCGTCGGAAGCGCGTTATGAAGAAGGC
ATTCCTTTGATTTCGCATGAGTCGGAAGTAATGGAGCAGGAACCCATGGAGCAGGAATCCATGGAAAGCGGCGAC
GGAGACCTCGGCGATCCTTTTGCTGGGGATGGTGAAAACGAAGACGACTTCTTCTCCCAAATGCATCAGCCTGCC
CAGCCACAGACAGAGGAGCGTCGCGAGCCCCTTGAGCGCAAGTCTACCATGCAGGTCATTGGGACAACGACCCCA
GAGCCAGTCTCAAGACAGAACACCTTGGGATCTACTGTCGAGGAACAAGACGAGGACCCTGGGGTCCAGAGTCAG
CAAAACGACGACGCGGCTAACAATGACTATTTGTCAGCATTGAAAGACGAACAAGGTCATGCCGAGGCTCTCCCC
TCTGAAGACATTGAATCCAAATGGCAACAAGCTTTTGCGGGGGACGATGAGGATGAGTTCCTGTTTGACGAGCCA
GCAACTGAACATCAAGATGTGGATCCAGCTGCATTCCTCGGAAGCGATGATGAAGGCCTCCTGGATGACGATGCC
GACGAAGCAGTGCCCGAGCCTCAGCCTGTACCACCTGCCCCTGCCAACCAACATGCATCTGTCCCAAGCCGGTAT
ACTCCGGTCAGCCTTCCGGCGCAGCAAACATCGAGCCCATATGTGCCTCAGGGGACCACACCTACACAGCCCAGC
GTGATACAACAAGGCCCATTTTCGTCGGCTTTGTATGCCCCATCGCAATATGGCCAAGCGCCAGCGCCTCGGCCC
CAGCCCTCAAGCACGCAAAGCTTCGTGGACAAGGCAAAAGGCGGCTACTCTTCTCCCTATGATCTGCCTTCGGAC
CTGATGCCAACTACAGTACAACCTCGAAAAAGGGCCAGCATGATACAGCTGCCCAACGAGCCTACGGCCCATCCT
CCAAGGAGTACAAACATGTATTCTCCAGCCCAAAATGCCCCGTTTAGTGCGGCTCCTGCTCAAGCTCCAGTTGCG
GCTCCGGTTCCAGCTCCAGCTCCGGGCGCGACCGCACAACGACCACCGCCCACTCACACATCTTCAACTCCAACG
ATGCACAGCCAGAGCAGCTTCTTCCAAGAGCTTCCTGTGTCGTCGAAGCCGCGGCAAGGCGCAAAAACGGCAGGG
CCTCAATCGCCGGCCGTTGCTAGTCCACCACCGCAGTCGAATTATGCGTTGCCTGGTGCACCTCACCAAACCTCT
GTCTCGCCATACGCCGCAGTGGGCAATCTTGTGCAGCCCGAGCGAGTGAGCCCTTATGCGCCGCTTCAGCACCCG
TCATCAGGCCCAGCCCCTATGCAAGCTCCCGGTCCTGCGCCACCAGGCAACACGAGATATTCATCGGCTCCAGCA
CAAGCCCAACTCCAACAGACGGCCCCGGCGCCCACTTCCAGCCGATACTCTCCGGTACCTGCAGGCCCTCGGCCC
GGCAGCTCATCGGGCCCGGCCTCAAATCCGCCACAGCCTGCTCTGCCGCATCTCCCTCGGACGTCGAGCCCTCTT
GCACAATTCGAGACGAGCATCAACAACCCTGATCGTCGGTCTAGCGCCTCATTTGAGCCTCGCTTGAGCCGTGTA
GCCTCGCTCCCTCCGACTCACGAAGTGGACGAAGACGAGGAAAACGGAGCCAGCCAAGCGTATCCCGTCTCCAAC
AACGCCTCCAGGTTTAGCCCAGCGTCTGTCCCATCAGTGGCCCGTCAAACCCCTCCCCTGGTTTCGAGTAAGCCT
GGTCCTCCAGCTCCATCGCCCCCGAAAAGAAGCACCACAAACTATGCCCCCCAGGCTGCTCCTGCTACCCAACCT
GGATTCGTTCCCCCGCCTCGACCATCGACTCAATCTCCCGGCACTACGCGTAGTAATCAGGGCTATAGGCCATCC
GACCATGGGGCCCGGCCTTCATCCGCCCATTCCATGGCACCACGGACTCATCACGTGCCAATGTCTCAGCAAGTC
TATGGAGCGAGTGCCGGCGCTCGCTCAAACCCGCTCTCCACTCACTCGGCCAACCTGGTGCCACCGACGGATGGA
AGGGAGCATGATCCCCTGCAACGGTGGAAGGGAGTGCCTTTGATTGCTTGGGGAGTGGGAGGCACTGTCATTACC
TCGTTCCCAAAAAGCTCGCCGCGGTACTCGGTAGCTCAGACAGCACCAGTCGTCTTGCGAACACCGGGTGAAGTC
AGGGTACAGAACATTCGGGAGATTGATGCGCTCTCGGAGCAGCACGTCAAGTTTCCAGGCCCCTTGAAGGGCAAA
TCGAAAAAGAAGGAGGCGCTCGCTTGGCTGTCTGCGGGCATTGATGCTCAGGAAAAAGAAATACCAGACGTGACA
TTTCACTCCCAGTTGTCGCTCGAGGCGAAGCGCGGCGTTGAACGTCTGCTCCTATGGAGGCTTCTCCGCATATTC
ATCGAGTTTGACGGAGCTTTGGAGGGCAGCAGTGCAGTTGAACAGGCTGTGCGAGGCGTGCTGTCTCCAGCCGTG
ACATCTCCCATGGCAGAAAACGACGGGCTGTATTATGCAGCTGCCACCTTTGCCCCCAAAACTGGCTCGACCAAC
GTGGCTTATGCAGACGCGGCAGATGGGTCGGCCGTGGAAAAGATGCGCAACAGTCTTCTCAGGGGCGATCGCGAG
AGCGCCGTCTGGGCTGCAGTAGACAAGCGTCTGTGGGGCCACGCCATGTTGATTTCGCACACGGTGTCTCCCGAT
CTATACAAGCGCGTGGCCCAGGAGTTTGTGCGCAAAGAAGTCAACTATCCGGGCCACAGCAACGAGTCTATGGCG
GCTCTGTACAAAGTCTTGTCTGGAAACTTTGACGACTGCGTCGACGAGCTGGTGCCAATCCATGCTCGGGCTGGC
CTTCAACTCGTGTCCAAAGAAGCTTCATCGGGCTCCACCAAGGACGTCATGGACGGGCTCGATAAGTGGCGAGAA
ACGCTGACGCTGATACTGAGCAACCGCAGCACCGACGATGTTCGAGGTCTGAATGCCCTGGGCAAGCTCTTGGCA
AGCTACGGCAGGGCGGAAGCTGCGCAGATATGCTTCATATTTAGCAGGACCCAGTCAGTCTTTGGCGGGCTGGAC
GACGGCGATGCTGACTTTGTCCTTGTTGGATCCGATCACCGGCAACAGCCCGACGGCTTCTTCAAGGAAACAGAA
GCGCTACAGCTCAGCGAGATGTATGAGTACGGCCTATCTCTTGCTGGAGGAGCTGCTGCCTCTGCCGGCGCTCCT
CATCTGGCAGGATACAAGCTGCAGCACGCCATTACGCTGGCCGAGTATGGGTACCGAGACAAGGCTCTTCAGTAC
TGCGATTCTATTTCTGCAGCCATCGTCTCACAGACGCGGCGATCTCCCTACCATCACGTGGTGCTCCAGGCGGCT
GTTGATGACTTTTCCAAGAGACTCAAGCAAGCTCCCAAGGACGGCTCCTCGTCGTGGATGTCCAAACCCAGCATG
GGCAAGGTGTCAGACAGCATGTGGAACCGCTTCAACAAGTTTGTGGCTGGCGACGAAGGCGGGGAGGGCTCTGCT
GGAGGCATGCATGACGCCGGCAACGGGCCATTTGCTCGGATTGCTGCAACACCCAGCATGAGTCGCTCGCCATCC
GCCTCCAACTTTGACAACTTTTCAACCACGTCGCCCATATATGGAGCTTCAGCACCCGTATCCGCCTCGGCCCAC
GCACCCGTCATGACGTCTCGATACGCTCCGGCCTCTGGACAGGCTGCTGTCGCGCCAAACCCATATGCGCCCGTG
TCAGAATATGCTCCAGGGCCTGCCGCTTCGTATGCGCCAGCGCAATACCCTGCAGCTGCCGCGTCGTTGGGGCCA
TCTATCAATGACGTGCCTCGCAATTCCTACGCACCTACGCATCCAGGGACTAGCCAGTCCCCTGCCGTGGGCCAT
GGCGGTTATGTGCCTCCAACATATTCTCCACAAGCCTCTGGATACCACCCAGTTTCACAGGTAGTTTCCCCTGCC
GTAACTGCTCAACATCACGCGCATCAGCCCCCACATTCCAGAGACTTCCAGCCGAGTGCTCTTCAAGCGAGTCCA
ATCATTTATCCCATGGACAACAGCATGGTAGCTGGCACATCTATGGAAAACATGCCGAGCAGCGTGGCAGCTGCC
AACGATCAAGGCTATGCGAAAGAAACTACGAGCAGTCATGGCGGCTATGTGCCTCCCTCGTATCAGCCCTACGGG
TACGAGCCACCATCGTATCAGCCTGAACCGGAGACTACTTCAGATGAAACCCAAGATGGGCCCCAAGCCAAAAAG
AAGAGTTTTATGGATGATGACGACCATTTGCCTGCCCTGAGGCCTCAAGGCAATTCCAAGCCCGACCAGAACCGT
GAGCACGACGAGTTGTTTCGCAAGGCAGTTGAAGAAGATGAGAAACGAGCCGCTGCACAGCAAGCCAACAAAAAA
GGATGGGGCTTCACGGGCTGGTTCAAAGGCGCTAAGAAGAACGAAGCCAATATTGGAGAGGCAACAGCTAACAAG
CCAATTCGCGCCAAACTTGGCGACGAGAGCAGCTTTGTCTACGACCCGGACCTCAAACGCTGGGTCAACAAAAAG
CCCGGTGCCGAAAATACCGAGGCCAAGAAGTCGACTCCGCCCCCGCCCAAGGCAGTACTTCGCAGTGCTAGTAGT
ACTTTAGCGCCCTCAGTATCGGAGATGATGTCCTCGGGCGGCCGTGCAAGTGCGCCTCCTCGGGCGCCTCCTCCG
CATGCATCTGAAGAGTCGGCCCAAAAGCCGCCAGATCTAAATGTTGGCGCTGGGACCCCAAGCATGAGCCGACAG
GCCTCATCGTCTGGCCCTATGGCACACTTGGCTAGCGAACCGCCCAGCCGACCTGGTACTAGCATGAGCAACGCC
AGCAGCATTGACGACTTACTAGGAGCGGCTGGGCCGCGCAAAAGCGGGCCCAAGAAACCCCGCAAAAGTGGGCGA
TATGTTGACGTTATGGCTAAGTAA
Gene >OphauG2|1352
ATGGCCTCCCGGCCACCCGGATCCTCGTGGAATCCGGCCTTGATGCCAGGCTCCGACATCAGCCCTGACCTTGAC
TATACAACTTCAGAGCGCGAGCCAGTTGAATCCGCGATCCCAGCCCCCGAGCCTCCAGTCCATGTTGAAGAACTC
AACCACTCCCCCCAAGACGCTCCATCTAGCGCCTCACCCGACCCCTTTCTGTCCAACGCTGTCGTGAATCAGGCT
GAAGAACAAGAGCCTATCGTTCAAAACTCTCCAAATCAAGACCATCAATTTCAACCCTTGGATGAACAGGTCAAT
GTTGATGCCCAAACAACGCATAGCTATGAACAAGACGAGTTCAATGGTGCAAGTGGTGCAGACCCAGAGGCTGTT
GAAGCTCTCTTTGAACAAAGCGCAGCTCATCCTTCAGCCGAGGAGCATAATCAAGATGGCGAGCTTGCTACCATG
AGTAGTACGACCCTCGAAGATGATCGAACCGGGAGCAATGCTTCAAAGACTGTCTCGAACACTGCAGATATTGAG
ACTGAATGGGGAATGGAGGGCACCGAGAAGATAGCCGACGATGGAATCCCTAGTCACCCTGAAACTACCGGGATA
GCACATGGGCAGCATTCCAGCTCTCTGTCGTTTGCTCGAACCGTCTCCCACCAAGTCAGCTTCATTGACGAAGAA
GAGACAGATTGGACTTTGCCACACCCTGGACCCGACGTCTCAACCTTCTTGCCGCCATCGGCTGAGAGAAGCAAT
TTTTTTCCACCCGTGCCCCCGGTGCAGTCCACAGATTCAAAATCGGAACATCAGCCTCTGCCAAGCACGCAAGCG
TCAGATATCTTGGGCACGATTTCGAATTATGACGACGCCGAGTCGCAAGATCTCGCCCCAGACACCCAACAAGAA
GGTTTCTGGCAATCTATTGGTGGCGAGGTCCAGAGTTTCGAAGCACAGGCGTCGGAAGCGCGTTATGAAGAAGGC
ATTCCTTTGATTTCGCATGAGTCGGAAGTAATGGAGCAGGAACCCATGGAGCAGGAATCCATGGAAAGCGGCGAC
GGAGACCTCGGCGATCCTTTTGCTGGGGATGGTGAAAACGAAGACGACTTCTTCTCCCAAATGCATCAGCCTGCC
CAGCCACAGACAGAGGAGCGTCGCGAGCCCCTTGAGCGCAAGTCTACCATGCAGGTCATTGGGACAACGACCCCA
GAGCCAGTCTCAAGACAGAACACCTTGGGATCTACTGTCGAGGAACAAGACGAGGACCCTGGGGTCCAGAGTCAG
CAAAACGACGACGCGGCTAACAATGACTATTTGTCAGCATTGAAAGACGAACAAGGTCATGCCGAGGCTCTCCCC
TCTGAAGACATTGAATCCAAATGGCAACAAGCTTTTGCGGGGGACGATGAGGATGAGTTCCTGTTTGACGAGCCA
GCAACTGAACATCAAGATGTGGATCCAGCTGCATTCCTCGGAAGCGATGATGAAGGCCTCCTGGATGACGATGCC
GACGAAGCAGTGCCCGAGCCTCAGCCTGTACCACCTGCCCCTGCCAACCAACATGCATCTGTCCCAAGCCGGTAT
ACTCCGGTCAGCCTTCCGGCGCAGCAAACATCGAGCCCATATGTGCCTCAGGGGACCACACCTACACAGCCCAGC
GTGATACAACAAGGCCCATTTTCGTCGGCTTTGTATGCCCCATCGCAATATGGCCAAGCGCCAGCGCCTCGGCCC
CAGCCCTCAAGCACGCAAAGCTTCGTGGACAAGGCAAAAGGCGGCTACTCTTCTCCCTATGATCTGCCTTCGGAC
CTGATGCCAACTACAGTACAACCTCGAAAAAGGGCCAGCATGATACAGCTGCCCAACGAGCCTACGGCCCATCCT
CCAAGGAGTACAAACATGTATTCTCCAGCCCAAAATGCCCCGTTTAGTGCGGCTCCTGCTCAAGCTCCAGTTGCG
GCTCCGGTTCCAGCTCCAGCTCCGGGCGCGACCGCACAACGACCACCGCCCACTCACACATCTTCAACTCCAACG
ATGCACAGCCAGAGCAGCTTCTTCCAAGAGCTTCCTGTGTCGTCGAAGCCGCGGCAAGGCGCAAAAACGGCAGGG
CCTCAATCGCCGGCCGTTGCTAGTCCACCACCGCAGTCGAATTATGCGTTGCCTGGTGCACCTCACCAAACCTCT
GTCTCGCCATACGCCGCAGTGGGCAATCTTGTGCAGCCCGAGCGAGTGAGCCCTTATGCGCCGCTTCAGCACCCG
TCATCAGGCCCAGCCCCTATGCAAGCTCCCGGTCCTGCGCCACCAGGCAACACGAGATATTCATCGGCTCCAGCA
CAAGCCCAACTCCAACAGACGGCCCCGGCGCCCACTTCCAGCCGATACTCTCCGGTACCTGCAGGCCCTCGGCCC
GGCAGCTCATCGGGCCCGGCCTCAAATCCGCCACAGCCTGCTCTGCCGCATCTCCCTCGGACGTCGAGCCCTCTT
GCACAATTCGAGACGAGCATCAACAACCCTGATCGTCGGTCTAGCGCCTCATTTGAGCCTCGCTTGAGCCGTGTA
GCCTCGCTCCCTCCGACTCACGAAGTGGACGAAGACGAGGAAAACGGAGCCAGCCAAGCGTATCCCGTCTCCAAC
AACGCCTCCAGGTTTAGCCCAGCGTCTGTCCCATCAGTGGCCCGTCAAACCCCTCCCCTGGTTTCGAGTAAGCCT
GGTCCTCCAGCTCCATCGCCCCCGAAAAGAAGCACCACAAACTATGCCCCCCAGGCTGCTCCTGCTACCCAACCT
GGATTCGTTCCCCCGCCTCGACCATCGACTCAATCTCCCGGCACTACGCGTAGTAATCAGGGCTATAGGCCATCC
GACCATGGGGCCCGGCCTTCATCCGCCCATTCCATGGCACCACGGACTCATCACGTGCCAATGTCTCAGCAAGTC
TATGGAGCGAGTGCCGGCGCTCGCTCAAACCCGCTCTCCACTCACTCGGCCAACCTGGTGCCACCGACGGATGGA
AGGGAGCATGATCCCCTGCAACGGTGGAAGGGAGTGCCTTTGATTGCTTGGGGAGTGGGAGGCACTGTCATTACC
TCGTTCCCAAAAAGCTCGCCGCGGTACTCGGTAGCTCAGACAGCACCAGTCGTCTTGCGAACACCGGGTGAAGTC
AGGGTACAGAACATTCGGGAGATTGATGCGCTCTCGGAGCAGCACGTCAAGTTTCCAGGCCCCTTGAAGGGCAAA
TCGAAAAAGAAGGAGGCGCTCGCTTGGCTGTCTGCGGGCATTGATGCTCAGGAAAAAGAAATACCAGACGTGACA
TTTCACTCCCAGTTGTCGCTCGAGGCGAAGCGCGGCGTTGAACGTCTGCTCCTATGGAGGCTTCTCCGCATATTC
ATCGAGTTTGACGGAGCTTTGGAGGGCAGCAGTGCAGTTGAACAGGCTGTGCGAGGCGTGCTGTCTCCAGCCGTG
ACATCTCCCATGGCAGAAAACGACGGGCTGTATTATGCAGCTGCCACCTTTGCCCCCAAAACTGGCTCGACCAAC
GTGGCTTATGCAGACGCGGCAGATGGGTCGGCCGTGGAAAAGATGCGCAACAGTCTTCTCAGGGGCGATCGCGAG
AGCGCCGTCTGGGCTGCAGTAGACAAGCGTCTGTGGGGCCACGCCATGTTGATTTCGCACACGGTGTCTCCCGAT
CTATACAAGCGCGTGGCCCAGGAGTTTGTGCGCAAAGAAGTCAACTATCCGGGCCACAGCAACGAGTCTATGGCG
GCTCTGTACAAAGTCTTGTCTGGAAACTTTGACGACTGCGTCGACGAGCTGGTGCCAATCCATGCTCGGGCTGGC
CTTCAACTCGTGTCCAAAGAAGCTTCATCGGGCTCCACCAAGGACGTCATGGACGGGCTCGATAAGTGGCGAGAA
ACGCTGACGCTGATACTGAGCAACCGCAGCACCGACGATGTTCGAGGTCTGAATGCCCTGGGCAAGCTCTTGGCA
AGCTACGGCAGGGCGGAAGCTGCGCAGATATGCTTCATATTTAGCAGGACCCAGTCAGTCTTTGGCGGGCTGGAC
GACGGCGATGCTGACTTTGTCCTTGTTGGATCCGATCACCGGCAACAGCCCGACGGCTTCTTCAAGGAAACAGAA
GCGCTACAGCTCAGCGAGATGTATGAGTACGGCCTATCTCTTGCTGGAGGAGCTGCTGCCTCTGCCGGCGCTCCT
CATCTGGCAGGATACAAGCTGCAGCACGCCATTACGCTGGCCGAGTATGGGTACCGAGACAAGGCTCTTCAGTAC
TGCGATTCTATTTCTGCAGCCATCGTCTCACAGACGCGGCGATCTCCCTACCATCACGTGGTGCTCCAGGCGGCT
GTTGATGACTTTTCCAAGAGACTCAAGCAAGCTCCCAAGGACGGCTCCTCGTCGTGGATGTCCAAACCCAGCATG
GGCAAGGTGTCAGACAGCATGTGGAACCGCTTCAACAAGTTTGTGGCTGGCGACGAAGGCGGGGAGGGCTCTGCT
GGAGGCATGCATGACGCCGGCAACGGGCCATTTGCTCGGATTGCTGCAACACCCAGCATGAGTCGCTCGCCATCC
GCCTCCAACTTTGACAACTTTTCAACCACGTCGCCCATATATGGAGCTTCAGCACCCGTATCCGCCTCGGCCCAC
GCACCCGTCATGACGTCTCGATACGCTCCGGCCTCTGGACAGGCTGCTGTCGCGCCAAACCCATATGCGCCCGTG
TCAGAATATGCTCCAGGGCCTGCCGCTTCGTATGCGCCAGCGCAATACCCTGCAGCTGCCGCGTCGTTGGGGCCA
TCTATCAATGACGTGCCTCGCAATTCCTACGCACCTACGCATCCAGGGACTAGCCAGTCCCCTGCCGTGGGCCAT
GGCGGTTATGTGCCTCCAACATATTCTCCACAAGCCTCTGGATACCACCCAGTTTCACAGGTAGTTTCCCCTGCC
GTAACTGCTCAACATCACGCGCATCAGCCCCCACATTCCAGAGACTTCCAGCCGAGTGCTCTTCAAGCGAGTCCA
ATCATTTATCCCATGGACAACAGCATGGTAGCTGGCACATCTATGGAAAACATGCCGAGCAGCGTGGCAGCTGCC
AACGATCAAGGCTATGCGAAAGAAACTACGAGCAGTCATGGCGGCTATGTGCCTCCCTCGTATCAGCCCTACGGG
TACGAGCCACCATCGTATCAGCCTGAACCGGAGACTACTTCAGATGAAACCCAAGATGGGCCCCAAGCCAAAAAG
AAGAGTTTTATGGATGATGACGACCATTTGCCTGCCCTGAGGCCTCAAGGCAATTCCAAGCCCGACCAGAACCGT
GAGCACGACGAGTTGTTTCGCAAGGCAGTTGAAGAAGATGGTAAGCTCCGTCTAATTAGTAGATATACAATGCCA
TTGACTGACAAGTTGGTTCAGAGAAACGAGCCGCTGCACAGCAAGCCAACAAAAAAGGATGGGGCTTCACGGGCT
GGTTCAAAGGCGCTAAGAAGAACGAAGCCAATATTGGAGAGGCAACAGCTAACAAGCCAATTCGCGCCAAACTTG
GCGACGAGAGCAGCTTTGTCTACGACCCGGACCTCAAACGCTGGGTCAACAAAAAGCCCGGTGCCGAAAATACCG
AGGCCAAGAAGTCGACTCCGCCCCCGCCCAAGGCAGTACTTCGCAGTGCTAGTAGTACTTTAGCGCCCTCAGTAT
CGGAGATGATGTCCTCGGGCGGCCGTGCAAGTGCGCCTCCTCGGGCGCCTCCTCCGCATGCATCTGAAGAGTCGG
CCCAAAAGCCGCCAGATCTAAATGTTGGCGCTGGGACCCCAAGCATGAGCCGACAGGCCTCATCGTCTGGCCCTA
TGGCACACTTGGCTAGCGAACCGCCCAGCCGACCTGGTACTAGCATGAGCAACGCCAGCAGCATTGACGACTTAC
TAGGAGCGGCTGGGCCGCGCAAAAGCGGGCCCAAGAAACCCCGCAAAAGTGGGCGATATGTTGACGTTATGGCTA
AGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail