Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|135
Gene name
LocationContig_1018:1138..1697
Strand-
Gene length (bp)559
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01900 RNase_P_Rpp14 Rpp14/Pop5 family 1.6E-35 7 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU90|POP5_SCHPO Ribonuclease P/MRP protein subunit POP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC830.09c PE=3 SV=1 1 132 6.0E-23
sp|P28005|POP5_YEAST Ribonuclease P/MRP protein subunit POP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP5 PE=1 SV=1 1 134 2.0E-16
sp|Q6AWV1|POP5_ARATH Probable ribonuclease P/MRP protein subunit POP5 OS=Arabidopsis thaliana GN=EMB1687 PE=2 SV=1 1 128 3.0E-11
sp|Q54EP3|POP5_DICDI Probable ribonuclease P/MRP protein subunit POP5 OS=Dictyostelium discoideum GN=pop5 PE=3 SV=1 1 128 1.0E-10
sp|Q969H6|POP5_HUMAN Ribonuclease P/MRP protein subunit POP5 OS=Homo sapiens GN=POP5 PE=1 SV=1 1 135 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU90|POP5_SCHPO Ribonuclease P/MRP protein subunit POP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC830.09c PE=3 SV=1 1 132 6.0E-23
sp|P28005|POP5_YEAST Ribonuclease P/MRP protein subunit POP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP5 PE=1 SV=1 1 134 2.0E-16
sp|Q6AWV1|POP5_ARATH Probable ribonuclease P/MRP protein subunit POP5 OS=Arabidopsis thaliana GN=EMB1687 PE=2 SV=1 1 128 3.0E-11
sp|Q54EP3|POP5_DICDI Probable ribonuclease P/MRP protein subunit POP5 OS=Dictyostelium discoideum GN=pop5 PE=3 SV=1 1 128 1.0E-10
sp|Q969H6|POP5_HUMAN Ribonuclease P/MRP protein subunit POP5 OS=Homo sapiens GN=POP5 PE=1 SV=1 1 135 2.0E-09
sp|Q5BJI6|POP5_DANRE Ribonuclease P/MRP protein subunit POP5 OS=Danio rerio GN=pop5 PE=2 SV=1 1 154 2.0E-09
sp|Q9DB28|POP5_MOUSE Ribonuclease P/MRP protein subunit POP5 OS=Mus musculus GN=Pop5 PE=1 SV=1 1 135 2.0E-09
sp|Q1JQ92|POP5_BOVIN Ribonuclease P/MRP protein subunit POP5 OS=Bos taurus GN=POP5 PE=2 SV=1 1 135 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0030677 ribonuclease P complex Yes
GO:0001682 tRNA 5'-leader removal Yes
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006399 tRNA metabolic process No
GO:0032991 protein-containing complex No
GO:1902555 endoribonuclease complex No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0008033 tRNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0099116 tRNA 5'-end processing No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000966 RNA 5'-end processing No
GO:0090304 nucleic acid metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:1902494 catalytic complex No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4457
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|135 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4220
Ophiocordyceps camponoti-floridani Ophcf2|04187
Ophiocordyceps camponoti-rufipedis Ophun1|3848
Ophiocordyceps kimflemingae Ophio5|1199
Ophiocordyceps subramaniannii Hirsu2|9253

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|135
MVRIKERYLLVNIIYPASPSAGVPDFVAQHQPTVANLTPHMLLKTIKAQAAILFGDYGAGAFEGRLSVKYLSLAT
STFILRCSRAHHQMLWAVLTLMDSVPAQNGQPCIFRVVRVSGTMRKLEEEAIRQSRALVLAAKEAAATLDASSGC
LAMAGAVTTA*
Coding >OphauG2|135
ATGGTGCGCATAAAGGAGCGATATCTCCTTGTCAACATCATCTATCCTGCCTCGCCCAGTGCAGGCGTCCCCGAC
TTTGTCGCGCAGCACCAGCCCACCGTTGCGAACCTGACGCCGCACATGCTGCTCAAGACCATCAAAGCCCAAGCA
GCAATCTTGTTTGGCGACTACGGCGCCGGCGCCTTTGAGGGCCGTCTTTCAGTCAAGTACCTATCGCTGGCCACG
TCCACCTTTATCCTCCGCTGCTCAAGAGCCCACCATCAGATGCTTTGGGCTGTGCTCACGCTCATGGATTCGGTG
CCGGCGCAAAATGGCCAGCCATGCATCTTTCGTGTTGTCCGCGTCAGCGGCACCATGCGCAAGCTGGAGGAGGAA
GCAATTCGCCAAAGCCGAGCCCTTGTCCTTGCGGCAAAGGAAGCGGCAGCGACTCTTGATGCAAGCTCGGGATGC
CTTGCCATGGCTGGGGCTGTCACCACGGCCTAG
Transcript >OphauG2|135
ATGGTGCGCATAAAGGAGCGATATCTCCTTGTCAACATCATCTATCCTGCCTCGCCCAGTGCAGGCGTCCCCGAC
TTTGTCGCGCAGCACCAGCCCACCGTTGCGAACCTGACGCCGCACATGCTGCTCAAGACCATCAAAGCCCAAGCA
GCAATCTTGTTTGGCGACTACGGCGCCGGCGCCTTTGAGGGCCGTCTTTCAGTCAAGTACCTATCGCTGGCCACG
TCCACCTTTATCCTCCGCTGCTCAAGAGCCCACCATCAGATGCTTTGGGCTGTGCTCACGCTCATGGATTCGGTG
CCGGCGCAAAATGGCCAGCCATGCATCTTTCGTGTTGTCCGCGTCAGCGGCACCATGCGCAAGCTGGAGGAGGAA
GCAATTCGCCAAAGCCGAGCCCTTGTCCTTGCGGCAAAGGAAGCGGCAGCGACTCTTGATGCAAGCTCGGGATGC
CTTGCCATGGCTGGGGCTGTCACCACGGCCTAG
Gene >OphauG2|135
ATGGTGCGCATAAAGGAGCGATATCTCCTTGTCAACATCATCTATCCTGCCTCGCCCAGTGCAGGCGTCCCCGAC
TTTGTCGCGCAGCACCAGCCCACCGTTGCGAACCTGACGCCGCACATGCTGCTCAAGACCATCAAAGCCCAAGCA
GCAATCTTGTTTGGCGACTACGGCGCCGGCGCCTTTGAGGGCCGTCTTTCAGGTTAGCCAAAGCCAGCGTGCTCT
CCTCTTGGTTTGCCCCAATTTGCGGCGACTAATCCTTTTTTCTTTCTTGCCAGTCAAGTACCTATCGCTGGCCAC
GTCCACCTTTATCCTCCGCTGCTCAAGAGCCCACCATCAGATGCTTTGGGCTGTGCTCACGCTCATGGATTCGGT
GCCGGCGCAAAATGGCCAGCCATGCATCTTTCGTGTTGTCCGCGTCAGCGGCACCATGCGCAAGCTGGAGGAGGA
AGCAATTCGCCAAAGCCGAGCCCTTGTCCTTGCGGCAAAGGAAGCGGCAGCGACTCTTGATGCAAGCTCGGGATG
CCTTGCCATGGCTGGGGCTGTCACCACGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail