Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1349
Gene name
LocationContig_14:41680..42704
Strand+
Gene length (bp)1024
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06999 Suc_Fer-like Sucrase/ferredoxin-like 2.4E-55 13 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5DK49|AIM32_PICGU Altered inheritance of mitochondria protein 32 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM32 PE=3 SV=2 153 312 6.0E-19
sp|Q6BPT6|AIM32_DEBHA Altered inheritance of mitochondria protein 32 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM32 PE=3 SV=2 1 311 2.0E-17
sp|C4Y1G7|AIM32_CLAL4 Altered inheritance of mitochondria protein 32 OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM32 PE=3 SV=1 112 309 1.0E-14
sp|B5VP80|AIM32_YEAS6 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|B3LLK7|AIM32_YEAS1 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5DK49|AIM32_PICGU Altered inheritance of mitochondria protein 32 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM32 PE=3 SV=2 153 312 6.0E-19
sp|Q6BPT6|AIM32_DEBHA Altered inheritance of mitochondria protein 32 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM32 PE=3 SV=2 1 311 2.0E-17
sp|C4Y1G7|AIM32_CLAL4 Altered inheritance of mitochondria protein 32 OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM32 PE=3 SV=1 112 309 1.0E-14
sp|B5VP80|AIM32_YEAS6 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|B3LLK7|AIM32_YEAS1 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|Q04689|AIM32_YEAST Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|C8ZEF8|AIM32_YEAS8 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|A6ZM17|AIM32_YEAS7 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|C7GS66|AIM32_YEAS2 Altered inheritance of mitochondria protein 32 OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM32 PE=3 SV=1 124 311 1.0E-10
sp|C5DDQ4|AIM32_LACTC Altered inheritance of mitochondria protein 32 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM32 PE=3 SV=1 154 310 8.0E-10
sp|Q6FLQ5|AIM32_CANGA Altered inheritance of mitochondria protein 32 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AIM32 PE=3 SV=1 154 311 4.0E-09
sp|D3XDD3|AIM32_SACKU Altered inheritance of mitochondria protein 32 OS=Saccharomyces kudriavzevii GN=AIM32 PE=3 SV=1 102 311 4.0E-09
sp|Q5XQP3|AIM32_SACK1 Altered inheritance of mitochondria protein 32 OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=AIM32 PE=3 SV=1 132 311 9.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6421
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1349 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6024
Ophiocordyceps camponoti-floridani Ophcf2|05374
Ophiocordyceps kimflemingae Ophio5|2354

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1349
MPEGVEIDHKSPLAGVMAGYAEQVLICTGRDDWASRIEEENSGDNLAADLKELLGRGGIYSDPFNVVSVLNASFP
CTPLPRTEVLNASAYLLPSFKYVPYLPRVSFDSVRMLVQGFLLPTKLHSAHAGLSPVHRDRLTRVPLAAQALPGV
CHVRDVLVLICGHGGRDGRCGIMGPVLRDEFIDKLARAGFDVRRGPISPPQGEKEENASANLQVPEQRATKPDSG
QTAMDLAAHESKTGARVGLVSHIGGHKFAGNVIIYLPPGLLRDGLAHPLAGHGIWYGRVEPRHVEGLVDETLLKG
RIVLDMMRGGIDAQRQILRP*
Coding >OphauG2|1349
ATGCCCGAGGGAGTCGAGATTGACCACAAAAGTCCGCTGGCCGGCGTCATGGCGGGCTATGCCGAGCAGGTACTC
ATCTGCACGGGACGGGACGACTGGGCCTCGCGCATAGAAGAGGAGAATAGCGGCGACAACCTGGCGGCCGATCTC
AAGGAACTGCTGGGCCGGGGGGGGATCTACAGTGACCCATTCAACGTGGTCTCGGTTCTAAACGCTTCGTTTCCT
TGCACGCCGCTCCCACGTACCGAGGTGCTCAATGCGTCGGCTTATCTCCTACCCAGCTTCAAGTACGTGCCGTAT
TTGCCGCGCGTCTCGTTCGACTCGGTGCGCATGCTTGTCCAGGGCTTTTTATTGCCCACCAAGCTGCACTCGGCG
CACGCAGGGCTGTCTCCCGTGCATCGCGACCGTCTGACGCGCGTACCCCTTGCGGCACAGGCACTGCCTGGAGTG
TGCCATGTGCGCGACGTGCTTGTCCTCATTTGCGGGCATGGAGGCCGAGATGGGCGCTGCGGCATCATGGGGCCT
GTGCTAAGGGACGAATTTATCGACAAACTGGCGCGTGCAGGCTTTGACGTGCGAAGAGGCCCAATATCCCCTCCA
CAGGGCGAGAAAGAGGAGAATGCGTCCGCAAATTTACAAGTCCCTGAGCAGAGAGCTACAAAACCCGACTCTGGC
CAAACCGCCATGGACCTGGCCGCCCACGAATCCAAGACGGGCGCAAGAGTCGGCCTCGTTAGCCACATTGGCGGA
CACAAATTTGCGGGCAATGTCATCATTTACCTGCCGCCGGGCTTGCTACGTGACGGTCTGGCACATCCCCTTGCT
GGCCATGGCATCTGGTATGGCAGAGTCGAGCCACGGCATGTGGAGGGCCTGGTGGACGAAACTCTTCTCAAGGGC
CGCATTGTCTTGGATATGATGCGGGGAGGCATTGATGCGCAGCGTCAGATACTCCGGCCATGA
Transcript >OphauG2|1349
ATGCCCGAGGGAGTCGAGATTGACCACAAAAGTCCGCTGGCCGGCGTCATGGCGGGCTATGCCGAGCAGGTACTC
ATCTGCACGGGACGGGACGACTGGGCCTCGCGCATAGAAGAGGAGAATAGCGGCGACAACCTGGCGGCCGATCTC
AAGGAACTGCTGGGCCGGGGGGGGATCTACAGTGACCCATTCAACGTGGTCTCGGTTCTAAACGCTTCGTTTCCT
TGCACGCCGCTCCCACGTACCGAGGTGCTCAATGCGTCGGCTTATCTCCTACCCAGCTTCAAGTACGTGCCGTAT
TTGCCGCGCGTCTCGTTCGACTCGGTGCGCATGCTTGTCCAGGGCTTTTTATTGCCCACCAAGCTGCACTCGGCG
CACGCAGGGCTGTCTCCCGTGCATCGCGACCGTCTGACGCGCGTACCCCTTGCGGCACAGGCACTGCCTGGAGTG
TGCCATGTGCGCGACGTGCTTGTCCTCATTTGCGGGCATGGAGGCCGAGATGGGCGCTGCGGCATCATGGGGCCT
GTGCTAAGGGACGAATTTATCGACAAACTGGCGCGTGCAGGCTTTGACGTGCGAAGAGGCCCAATATCCCCTCCA
CAGGGCGAGAAAGAGGAGAATGCGTCCGCAAATTTACAAGTCCCTGAGCAGAGAGCTACAAAACCCGACTCTGGC
CAAACCGCCATGGACCTGGCCGCCCACGAATCCAAGACGGGCGCAAGAGTCGGCCTCGTTAGCCACATTGGCGGA
CACAAATTTGCGGGCAATGTCATCATTTACCTGCCGCCGGGCTTGCTACGTGACGGTCTGGCACATCCCCTTGCT
GGCCATGGCATCTGGTATGGCAGAGTCGAGCCACGGCATGTGGAGGGCCTGGTGGACGAAACTCTTCTCAAGGGC
CGCATTGTCTTGGATATGATGCGGGGAGGCATTGATGCGCAGCGTCAGATACTCCGGCCATGA
Gene >OphauG2|1349
ATGCCCGAGGGAGTCGAGATTGACCACAAAAGTCCGCTGGCCGGCGTCATGGCGGGCTATGCCGAGCAGGTACTC
ATCTGCACGGGACGGGACGACTGGGCCTCGCGCATAGAAGAGGAGAATAGCGGCGACAACCTGGCGGCCGATCTC
AAGGAACTGCTGGGCCGGGGGGGGATCTACAGTGACGTATGACTTATGCCTCGATGCCTTCTCCAGCCTGCGGGA
CTAACGTCGAGTACAATGGTAGCCATTCAACGTGGTCTCGGTTCTAAACGCTTCGTTTCCTTGCACGCCGCTCCC
ACGTACCGAGGTGCTCAATGCGTCGGCTTATCTCCTACCCAGCTTCAAGTACGTGCCGTATTTGCCGCGCGTCTC
GTTCGACTCGGTGCGCATGCTTGTCCAGGGCTTTTTATTGCCCACCAAGCTGCACTCGGCGCACGCAGGGCTGTC
TCCCGTGCATCGCGACCGTCTGACGCGCGTACCCCTTGCGGCACAGGCACTGCCTGGAGTGTGCCATGTGCGCGA
CGTGCTTGTCCTCATTTGCGGGCATGGAGGCCGAGATGGGCGCTGCGGCATCATGGGGCCTGTGCTAAGGGACGA
ATTTATCGACAAACTGGCGCGTGCAGGCTTTGACGTGCGAAGAGGCCCAATATCCCCTCCACAGGGCGAGAAAGA
GGAGAATGCGTCCGCAAATTTACAAGTCCCTGAGCAGAGAGCTACAAAACCCGACTCTGGCCAAACCGCCATGGA
CCTGGCCGCCCACGAATCCAAGACGGGCGCAAGAGTCGGCCTCGTTAGCCACATTGGCGGACACAAATTTGCGGG
CAATGTCATCATTTACCTGCCGCCGGGCTTGCTACGTGACGGTCTGGCACATCCCCTTGCTGGCCATGGCATCTG
GTATGGCAGAGTCGAGCCACGGCATGTGGAGGGCCTGGTGGACGAAACTCTTCTCAAGGGCCGCATTGTCTTGGA
TATGATGCGGGGAGGCATTGATGCGCAGCGTCAGATACTCCGGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail