Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1348
Gene name
LocationContig_14:38078..40473
Strand-
Gene length (bp)2395
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 5.7E-85 367 749

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 118 748 5.0E-162
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 189 753 2.0E-144
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 197 750 1.0E-128
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 363 745 7.0E-36
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 275 749 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 118 748 5.0E-162
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 189 753 2.0E-144
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 197 750 1.0E-128
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 363 745 7.0E-36
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 275 749 4.0E-31
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 310 758 5.0E-31
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 363 743 7.0E-31
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 328 745 1.0E-29
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 377 745 1.0E-29
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 377 745 2.0E-29
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 328 745 2.0E-29
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 345 745 4.0E-29
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 339 749 1.0E-28
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 369 651 2.0E-27
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 360 651 2.0E-27
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 350 745 3.0E-27
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 343 745 5.0E-25
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 350 745 2.0E-24
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 331 750 5.0E-24
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 331 754 5.0E-13
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 330 756 1.0E-10
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 314 761 1.0E-10
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 309 761 1.0E-09
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 309 761 2.0E-09
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 356 756 6.0E-09
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 316 652 4.0E-08
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 339 756 4.0E-08
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 373 759 2.0E-07
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 349 756 1.0E-06
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 311 512 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 398 420 22
2 441 463 22
3 483 502 19
4 509 531 22
5 551 570 19
6 583 605 22
7 629 651 22
8 672 689 17
9 694 711 17
10 731 753 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1348
MSSPQKTPSLTPRASSPSPALAALPSALRSYSSSIPREELTARLAEPIPSQTPVRTDSPQPGISTPDHASGSIVG
GSSYNQGPGVSALAAALSDSLGQSSKLLGTPAARASSPTPPQPSQSPGPSAPPETSTNYGSVDSRGRFAGPASVG
PYEDPEIVKRHLVQPGEAETAPSEDSSVHGTARGKQPAETVGAGLNDDEFSSLRLQGGDITRGIYKWTEQAEAKN
RLQRSRSFDHSRPEPVAEVLDINSIKVPGGFRRNHLRRTALSPSGHAASSGSGRGTDAESLPAEPRLFTSSFLEF
LTIYGHFAGEELEEDDEALGPNEEFWSGEDRDGGGDSDDGNEPMEDSALLPPSKKRRKRKARGGSGKNSAFNAAL
LLLKSFVGTGVLFLPRAFLNGGMLFSNLVLLGVACLSYYCFVLLVTTRLNIEGSFGDMGGMLYGRWMRTAILSSI
VISQIGFVAAYTVFTAENLQAFIHAVSECRSNISIPVLILMQMVIFLPFSLLRDIGKLGFTALIADAFILIGLAY
LFYYDVLTLYTEGLADIILFNQRDWTLFIGTAIFTFEGIGLIIPIQESMKQPQKFPRVLLLVMVIITVIFVVMGA
LSYAAYGSKTETVVLLNLPQDNKMVNVVQLLYSVAILLSTPLQIFPAIRIIETELFTRSGKYNPYIKWQKNVFRF
FMVMTCAAIAWGGADNLDKFVALVGNFACIPLVYIYPPLMHYRAVARSRSRKISDVILCIFGVVAMVYATSLTIM
SWANSSPKPPGYCEGKHP*
Coding >OphauG2|1348
ATGTCCTCGCCGCAAAAGACCCCCTCCCTGACGCCCAGGGCTTCGTCTCCCTCTCCCGCCCTGGCAGCTCTCCCT
TCAGCTCTGCGGTCCTACTCGTCTTCGATCCCGCGAGAGGAGCTTACGGCTCGCTTGGCTGAGCCTATTCCATCC
CAAACTCCCGTGCGCACCGACTCTCCCCAGCCAGGCATCAGCACTCCCGACCACGCTTCCGGCTCCATCGTGGGT
GGAAGCTCGTACAACCAGGGACCCGGCGTGTCGGCTCTTGCCGCTGCCTTGTCCGACTCTCTTGGCCAGTCGTCG
AAGCTGCTTGGCACCCCCGCCGCTCGTGCGAGCTCGCCCACGCCCCCACAGCCGTCCCAGAGCCCCGGCCCGTCT
GCACCACCCGAGACATCAACAAACTACGGCTCCGTGGACTCGAGGGGCCGCTTTGCCGGTCCAGCAAGTGTTGGC
CCCTATGAGGACCCTGAGATTGTGAAGCGTCATCTTGTACAGCCCGGGGAAGCCGAGACTGCACCGTCTGAGGAC
TCGTCGGTGCATGGCACCGCTCGCGGCAAGCAGCCGGCCGAGACGGTTGGCGCTGGACTCAACGACGACGAGTTT
TCGAGTTTGCGTCTCCAGGGCGGCGACATCACTCGCGGCATCTACAAGTGGACTGAGCAGGCAGAGGCCAAGAAT
AGATTGCAGCGCAGCAGGAGCTTCGACCACTCGCGGCCCGAGCCTGTAGCCGAAGTGCTAGATATCAACTCAATC
AAGGTGCCGGGCGGTTTTCGCAGAAACCATCTCCGCCGTACTGCCCTTAGTCCCAGTGGCCACGCAGCTAGCAGT
GGAAGCGGGCGCGGAACTGATGCCGAGTCACTGCCGGCGGAGCCTCGCCTATTTACGTCGAGCTTCCTCGAGTTT
CTGACCATCTACGGCCACTTTGCTGGTGAAGAGCTTGAAGAGGATGATGAGGCGCTGGGGCCAAACGAAGAGTTT
TGGTCAGGCGAAGACCGCGATGGAGGCGGCGATAGCGATGACGGCAACGAGCCCATGGAAGACAGCGCGCTGCTG
CCACCATCCAAGAAGAGACGTAAGCGCAAGGCCCGCGGTGGCAGCGGCAAAAACAGTGCCTTCAACGCGGCGCTG
TTGCTTCTCAAGTCTTTTGTCGGCACCGGCGTTCTCTTTCTCCCACGAGCTTTTCTTAATGGCGGCATGTTGTTT
AGCAATCTGGTGCTGCTGGGCGTTGCCTGTCTGAGCTACTACTGCTTCGTTTTGCTCGTTACGACGCGTCTCAAC
ATTGAGGGCTCCTTTGGTGACATGGGAGGCATGCTGTACGGCCGCTGGATGCGTACAGCCATTCTTTCATCCATT
GTTATTAGCCAGATTGGCTTCGTCGCCGCCTATACCGTCTTTACGGCCGAAAACCTCCAGGCCTTTATACATGCA
GTGTCGGAATGCCGCAGCAATATTAGCATTCCTGTGCTCATCTTGATGCAAATGGTCATCTTTCTGCCCTTTTCT
CTTTTGCGCGACATTGGCAAGCTCGGCTTCACGGCACTGATTGCAGATGCCTTTATCCTCATTGGGCTTGCCTAC
CTCTTTTACTACGACGTCTTGACATTATACACCGAGGGCCTAGCAGACATTATTCTCTTCAACCAAAGAGACTGG
ACTCTGTTTATCGGAACGGCCATTTTTACCTTTGAAGGAATCGGCCTCATCATCCCCATACAGGAGTCGATGAAG
CAGCCGCAAAAGTTTCCGCGAGTGCTGCTCCTTGTCATGGTCATCATCACCGTCATTTTCGTTGTCATGGGCGCC
CTGTCGTACGCAGCATACGGGTCAAAGACGGAGACGGTGGTGCTGCTCAATTTGCCGCAAGACAACAAAATGGTC
AACGTGGTACAGCTGCTGTACTCGGTCGCCATCCTCCTGTCGACGCCGCTGCAAATCTTCCCCGCCATTCGAATC
ATTGAGACGGAGCTGTTTACGCGCAGTGGCAAGTACAATCCATACATCAAGTGGCAGAAGAATGTATTCCGCTTC
TTCATGGTGATGACGTGCGCCGCCATTGCCTGGGGAGGTGCTGATAATCTGGACAAATTTGTTGCCCTCGTGGGC
AACTTTGCATGCATCCCGCTCGTCTACATCTACCCGCCCTTGATGCACTACAGAGCCGTGGCGCGCAGCCGAAGT
CGGAAAATCTCTGATGTTATATTGTGTATATTCGGCGTGGTGGCCATGGTGTATGCAACCAGTCTGACCATTATG
AGCTGGGCGAATTCGTCGCCCAAGCCACCGGGATACTGTGAAGGGAAGCATCCATGA
Transcript >OphauG2|1348
ATGTCCTCGCCGCAAAAGACCCCCTCCCTGACGCCCAGGGCTTCGTCTCCCTCTCCCGCCCTGGCAGCTCTCCCT
TCAGCTCTGCGGTCCTACTCGTCTTCGATCCCGCGAGAGGAGCTTACGGCTCGCTTGGCTGAGCCTATTCCATCC
CAAACTCCCGTGCGCACCGACTCTCCCCAGCCAGGCATCAGCACTCCCGACCACGCTTCCGGCTCCATCGTGGGT
GGAAGCTCGTACAACCAGGGACCCGGCGTGTCGGCTCTTGCCGCTGCCTTGTCCGACTCTCTTGGCCAGTCGTCG
AAGCTGCTTGGCACCCCCGCCGCTCGTGCGAGCTCGCCCACGCCCCCACAGCCGTCCCAGAGCCCCGGCCCGTCT
GCACCACCCGAGACATCAACAAACTACGGCTCCGTGGACTCGAGGGGCCGCTTTGCCGGTCCAGCAAGTGTTGGC
CCCTATGAGGACCCTGAGATTGTGAAGCGTCATCTTGTACAGCCCGGGGAAGCCGAGACTGCACCGTCTGAGGAC
TCGTCGGTGCATGGCACCGCTCGCGGCAAGCAGCCGGCCGAGACGGTTGGCGCTGGACTCAACGACGACGAGTTT
TCGAGTTTGCGTCTCCAGGGCGGCGACATCACTCGCGGCATCTACAAGTGGACTGAGCAGGCAGAGGCCAAGAAT
AGATTGCAGCGCAGCAGGAGCTTCGACCACTCGCGGCCCGAGCCTGTAGCCGAAGTGCTAGATATCAACTCAATC
AAGGTGCCGGGCGGTTTTCGCAGAAACCATCTCCGCCGTACTGCCCTTAGTCCCAGTGGCCACGCAGCTAGCAGT
GGAAGCGGGCGCGGAACTGATGCCGAGTCACTGCCGGCGGAGCCTCGCCTATTTACGTCGAGCTTCCTCGAGTTT
CTGACCATCTACGGCCACTTTGCTGGTGAAGAGCTTGAAGAGGATGATGAGGCGCTGGGGCCAAACGAAGAGTTT
TGGTCAGGCGAAGACCGCGATGGAGGCGGCGATAGCGATGACGGCAACGAGCCCATGGAAGACAGCGCGCTGCTG
CCACCATCCAAGAAGAGACGTAAGCGCAAGGCCCGCGGTGGCAGCGGCAAAAACAGTGCCTTCAACGCGGCGCTG
TTGCTTCTCAAGTCTTTTGTCGGCACCGGCGTTCTCTTTCTCCCACGAGCTTTTCTTAATGGCGGCATGTTGTTT
AGCAATCTGGTGCTGCTGGGCGTTGCCTGTCTGAGCTACTACTGCTTCGTTTTGCTCGTTACGACGCGTCTCAAC
ATTGAGGGCTCCTTTGGTGACATGGGAGGCATGCTGTACGGCCGCTGGATGCGTACAGCCATTCTTTCATCCATT
GTTATTAGCCAGATTGGCTTCGTCGCCGCCTATACCGTCTTTACGGCCGAAAACCTCCAGGCCTTTATACATGCA
GTGTCGGAATGCCGCAGCAATATTAGCATTCCTGTGCTCATCTTGATGCAAATGGTCATCTTTCTGCCCTTTTCT
CTTTTGCGCGACATTGGCAAGCTCGGCTTCACGGCACTGATTGCAGATGCCTTTATCCTCATTGGGCTTGCCTAC
CTCTTTTACTACGACGTCTTGACATTATACACCGAGGGCCTAGCAGACATTATTCTCTTCAACCAAAGAGACTGG
ACTCTGTTTATCGGAACGGCCATTTTTACCTTTGAAGGAATCGGCCTCATCATCCCCATACAGGAGTCGATGAAG
CAGCCGCAAAAGTTTCCGCGAGTGCTGCTCCTTGTCATGGTCATCATCACCGTCATTTTCGTTGTCATGGGCGCC
CTGTCGTACGCAGCATACGGGTCAAAGACGGAGACGGTGGTGCTGCTCAATTTGCCGCAAGACAACAAAATGGTC
AACGTGGTACAGCTGCTGTACTCGGTCGCCATCCTCCTGTCGACGCCGCTGCAAATCTTCCCCGCCATTCGAATC
ATTGAGACGGAGCTGTTTACGCGCAGTGGCAAGTACAATCCATACATCAAGTGGCAGAAGAATGTATTCCGCTTC
TTCATGGTGATGACGTGCGCCGCCATTGCCTGGGGAGGTGCTGATAATCTGGACAAATTTGTTGCCCTCGTGGGC
AACTTTGCATGCATCCCGCTCGTCTACATCTACCCGCCCTTGATGCACTACAGAGCCGTGGCGCGCAGCCGAAGT
CGGAAAATCTCTGATGTTATATTGTGTATATTCGGCGTGGTGGCCATGGTGTATGCAACCAGTCTGACCATTATG
AGCTGGGCGAATTCGTCGCCCAAGCCACCGGGATACTGTGAAGGGAAGCATCCATGA
Gene >OphauG2|1348
ATGTCCTCGCCGCAAAAGACCCCCTCCCTGACGCCCAGGGCTTCGTCTCCCTCTCCCGCCCTGGCAGCTCTCCCT
TCAGCTCTGCGGTCCTACTCGTCTTCGATCCCGCGAGAGGAGCTTACGGCTCGCTTGGCTGAGCCTATTCCATCC
CAAACTCCCGTGCGCACCGACTCTCCCCAGCCAGGCATCAGCACTCCCGACCACGCTTCCGGCTCCATCGTGGGT
GGAAGCTCGTACAACCAGGGACCCGGCGTGTCGGCTCTTGCCGCTGCCTTGTCCGACTCTCTTGGCCAGTCGTCG
AAGCTGCTTGGCACCCCCGCCGCTCGTGCGAGCTCGCCCACGCCCCCACAGCCGTCCCAGAGCCCCGGCCCGTCT
GCACCACCCGAGACATCAACAAACTACGGCTCCGTGGACTCGAGGGGCCGCTTTGCCGGTCCAGCAAGTGTTGGC
CCCTATGAGGACCCTGAGATTGTGAAGCGTCATCTTGTACAGCCCGGGGAAGCCGAGACTGCACCGTCTGAGGAC
TCGTCGGTGCATGGCACCGCTCGCGGCAAGCAGCCGGCCGAGACGGTTGGCGCTGGACTCAACGACGACGAGTTT
TCGAGTTTGCGTCTCCAGGGCGGCGACATCACTCGCGGCATCTACAAGTGGACTGAGCAGGCAGAGGCCAAGAAT
AGATTGCAGCGCAGCAGGAGCTTCGACCACTCGCGGCCCGAGCCTGTAGCCGAAGTGCTAGATATCAACTCAATC
AAGGTGCCGGGCGGTTTTCGCAGAAACCATCTCCGCCGTACTGCCCTTAGTCCCAGTGGCCACGCAGCTAGCAGT
GGAAGCGGGCGCGGAACTGATGCCGAGTCACTGCCGGCGGAGCCTCGCCTATTTACGTCGAGCTTCCTCGAGTTT
CTGACCATCTACGGCCACTTTGCTGGTGAAGAGCTTGAAGAGGATGATGAGGCGCTGGGGCCAAACGAAGAGTTT
TGGTCAGGCGAAGACCGCGATGGAGGCGGCGATAGCGATGACGGCAACGAGCCCATGGAAGACAGCGCGCTGCTG
CCACCATCCAAGAAGAGACGTAAGCGCAAGGCCCGCGGTGGCAGCGGCAAAAACAGTGCCTTCAACGCGGCGCTG
TTGCTTCTCAAGTCTTTTGTCGGCACCGGCGTTCTCTTTCTCCCACGAGCTTTTCTTAATGGCGGCATGTTGTTT
AGCAATCTGGTGCTGCTGGGCGTTGCCTGTCTGAGCTACTACTGCTTCGTTTTGCTCGTTACGACGCGTCTCAAC
ATTGAGGGCTCCTTTGGTGACATGGGAGGCATGCTGTACGGCCGCTGGATGCGTACAGCCATTCTTTCATCCATT
GTTATTAGCCAGATTGGCTTCGTCGCCGCCTATACCGTCTTTACGGCCGAAAACCTCCAGGCCTTTATACATGCA
GTGTCGGAATGCCGCAGCAATATTAGCATTCCTGTGCTCATCTTGATGCAAATGGTCATCTTTCTGCCCTTTTCT
CTTTTGCGCGACATTGGCAAGCTCGGCTTCACGGCACTGATTGCAGATGCCTTTATCCTCATTGGGCTTGCCTAC
CTCTTTTACTACGACGTCTTGACATTATACACCGAGGGCCTAGCAGACATTATTCTCTTCAACCAAAGAGACTGG
ACTCTGTTTATCGGAACGGCCATTTTTACCTTTGAAGGAATCGGCCTCATCATCCCCATACAGGAGTCGATGAAG
CAGCCGCAAAAGTTTCCGCGAGTGCTGCTCCTTGTCATGGTCATCATCACCGTCATTTTCGTTGTCATGGGCGCC
CTGTCGTACGCAGCATACGGGTCAAAGACGGAGACGGTGGTGCTGCTCAATTTGCCGCAAGACAACAAAATGGTC
AACGTGGTACAGCTGCTGTACTCGGTCGCCATCCTCCTGTCGACGCCGCTGCAAATCTTCCCCGCCATTCGAATC
ATTGAGACGGAGCTGTTTACGCGCAGTGGCAAGTACAATCCATACATCAAGTGGCAGAAGAATGTATTCCGCTTC
TTCATGGTGATGACGTGCGCCGCCATTGCCTGGGGAGGTGCTGATAATCTGGACAAATTTGTTGCCCTCGTGGGC
AACTTTGCATGCATCCCGCTCGTCTACATCTACCCGGTATGTTTCTCATCTGCCGTGTGCCAACCTCTCTTGTCT
ACCTGGCCATCGGTCAAGGCCTTGGTTTTGTAGCTAATCAGTCGCGAAGCCCTTGATGCACTACAGAGCCGTGGC
GCGCAGCCGAAGTCGGAAAATCTCTGATGTTATATTGTGTATATTCGGCGTGGTGGCCATGGTGTATGCAACCAG
TCTGACCATTATGAGCTGGGCGAATTCGTCGCCCAAGCCACCGGGATACTGTGAAGGGAAGCATCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail