Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1343
Gene name
LocationContig_14:28032..29820
Strand-
Gene length (bp)1788
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family 3.7E-103 112 541

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGG8|GDA1_ASPFU Probable guanosine-diphosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gda1 PE=3 SV=2 44 546 0.0E+00
sp|Q9HEM6|GDA1_KLULA Guanosine-diphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GDA1 PE=3 SV=1 95 545 7.0E-158
sp|Q9UT35|GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdp1 PE=3 SV=1 104 544 1.0E-155
sp|P32621|GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDA1 PE=1 SV=1 113 543 2.0E-151
sp|Q8TGH6|GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDA1 PE=3 SV=1 112 542 1.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGG8|GDA1_ASPFU Probable guanosine-diphosphatase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gda1 PE=3 SV=2 44 546 0.0E+00
sp|Q9HEM6|GDA1_KLULA Guanosine-diphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GDA1 PE=3 SV=1 95 545 7.0E-158
sp|Q9UT35|GDA1_SCHPO Guanosine-diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdp1 PE=3 SV=1 104 544 1.0E-155
sp|P32621|GDA1_YEAST Guanosine-diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDA1 PE=1 SV=1 113 543 2.0E-151
sp|Q8TGH6|GDA1_CANAL Guanosine-diphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDA1 PE=3 SV=1 112 542 1.0E-150
sp|Q9ER31|ENTP6_RAT Ectonucleoside triphosphate diphosphohydrolase 6 OS=Rattus norvegicus GN=Entpd6 PE=1 SV=1 112 527 3.0E-52
sp|E1C1L6|ENTP5_CHICK Ectonucleoside triphosphate diphosphohydrolase 5 OS=Gallus gallus GN=ENTPD5 PE=3 SV=1 114 532 1.0E-49
sp|O75354|ENTP6_HUMAN Ectonucleoside triphosphate diphosphohydrolase 6 OS=Homo sapiens GN=ENTPD6 PE=1 SV=3 112 527 4.0E-48
sp|E1BPW0|ENTP5_BOVIN Ectonucleoside triphosphate diphosphohydrolase 5 OS=Bos taurus GN=ENTPD5 PE=3 SV=1 114 532 5.0E-47
sp|D2GZV9|ENTP5_AILME Ectonucleoside triphosphate diphosphohydrolase 5 OS=Ailuropoda melanoleuca GN=ENTPD5 PE=3 SV=1 114 532 2.0E-46
sp|Q6P6S9|ENTP5_RAT Ectonucleoside triphosphate diphosphohydrolase 5 OS=Rattus norvegicus GN=Entpd5 PE=2 SV=1 114 532 1.0E-44
sp|O55026|ENTP2_MOUSE Ectonucleoside triphosphate diphosphohydrolase 2 OS=Mus musculus GN=Entpd2 PE=1 SV=2 107 531 2.0E-44
sp|Q9SQG2|APY1_ARATH Apyrase 1 OS=Arabidopsis thaliana GN=APY1 PE=1 SV=1 113 529 3.0E-44
sp|Q8H7L6|APY1_ORYSJ Probable apyrase 1 OS=Oryza sativa subsp. japonica GN=APY1 PE=3 SV=1 113 531 2.0E-43
sp|Q9WUZ9|ENTP5_MOUSE Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mus musculus GN=Entpd5 PE=1 SV=1 114 532 2.0E-43
sp|Q2QYE1|APY3_ORYSJ Probable apyrase 3 OS=Oryza sativa subsp. japonica GN=APY3 PE=2 SV=2 113 534 3.0E-43
sp|O75356|ENTP5_HUMAN Ectonucleoside triphosphate diphosphohydrolase 5 OS=Homo sapiens GN=ENTPD5 PE=1 SV=1 114 532 1.0E-42
sp|Q9SPM5|APY2_ARATH Apyrase 2 OS=Arabidopsis thaliana GN=APY2 PE=1 SV=1 113 529 2.0E-42
sp|Q6Z4P2|APY2_ORYSJ Probable apyrase 2 OS=Oryza sativa subsp. japonica GN=APY2 PE=2 SV=1 113 529 4.0E-42
sp|O35795|ENTP2_RAT Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus GN=Entpd2 PE=1 SV=1 107 531 6.0E-42
sp|Q9QYC8|ENTP5_MESAU Ectonucleoside triphosphate diphosphohydrolase 5 OS=Mesocricetus auratus GN=ENTPD5 PE=2 SV=1 114 523 1.0E-41
sp|Q9Y5L3|ENTP2_HUMAN Ectonucleoside triphosphate diphosphohydrolase 2 OS=Homo sapiens GN=ENTPD2 PE=1 SV=1 107 531 3.0E-41
sp|P80595|APY_SOLTU Apyrase OS=Solanum tuberosum GN=RROP1 PE=1 SV=2 113 531 6.0E-41
sp|Q9XU84|UDA1_CAEEL Nucleoside-diphosphatase uda-1 OS=Caenorhabditis elegans GN=uda-1 PE=1 SV=1 114 529 4.0E-40
sp|P52914|NTPA_PEA Nucleoside-triphosphatase OS=Pisum sativum PE=2 SV=1 90 529 7.0E-38
sp|P49961|ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens GN=ENTPD1 PE=1 SV=1 112 531 3.0E-37
sp|P97687|ENTP1_RAT Ectonucleoside triphosphate diphosphohydrolase 1 OS=Rattus norvegicus GN=Entpd1 PE=1 SV=1 106 531 1.0E-36
sp|P55772|ENTP1_MOUSE Ectonucleoside triphosphate diphosphohydrolase 1 OS=Mus musculus GN=Entpd1 PE=1 SV=1 106 531 2.0E-35
sp|P40009|YND1_YEAST Golgi apyrase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YND1 PE=1 SV=1 113 536 1.0E-33
sp|O80612|APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana GN=APY6 PE=2 SV=2 112 527 1.0E-33
sp|O93295|ENTP8_CHICK Ectonucleoside triphosphate diphosphohydrolase 8 OS=Gallus gallus GN=ENTPD8 PE=1 SV=1 110 531 1.0E-32
sp|P79784|ENTP2_CHICK Ectonucleoside triphosphate diphosphohydrolase 2 OS=Gallus gallus GN=ENTPD2 PE=1 SV=2 106 531 2.0E-32
sp|Q8H1D8|APY4_ARATH Probable apyrase 4 OS=Arabidopsis thaliana GN=APY4 PE=2 SV=1 112 527 9.0E-32
sp|Q21815|MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans GN=mig-23 PE=1 SV=2 114 529 6.0E-31
sp|O75355|ENTP3_HUMAN Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens GN=ENTPD3 PE=1 SV=2 110 531 4.0E-30
sp|Q8K0L2|ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus GN=Entpd8 PE=1 SV=3 113 531 4.0E-30
sp|Q5DRK1|ENTP8_RAT Ectonucleoside triphosphate diphosphohydrolase 8 OS=Rattus norvegicus GN=Entpd8 PE=1 SV=1 113 531 5.0E-30
sp|Q617Y0|MIG23_CAEBR Nucleoside-diphosphatase mig-23 OS=Caenorhabditis briggsae GN=mig-23 PE=3 SV=1 114 529 8.0E-30
sp|Q6NQA8|APY5_ARATH Probable apyrase 5 OS=Arabidopsis thaliana GN=APY5 PE=2 SV=1 112 527 1.0E-29
sp|Q9XI62|APY3_ARATH Probable apyrase 3 OS=Arabidopsis thaliana GN=APY3 PE=2 SV=1 89 544 2.0E-29
sp|O18956|ENTP1_BOVIN Ectonucleoside triphosphate diphosphohydrolase 1 OS=Bos taurus GN=ENTPD1 PE=1 SV=1 112 531 6.0E-29
sp|Q18411|NTP1_CAEEL Nucleoside-triphosphatase ntp-1 OS=Caenorhabditis elegans GN=ntp-1 PE=1 SV=1 100 529 6.0E-29
sp|Q5REF6|ENTP7_PONAB Ectonucleoside triphosphate diphosphohydrolase 7 OS=Pongo abelii GN=ENTPD7 PE=2 SV=1 103 529 3.0E-28
sp|Q9DBT4|ENTP4_MOUSE Ectonucleoside triphosphate diphosphohydrolase 4 OS=Mus musculus GN=Entpd4 PE=1 SV=1 102 529 5.0E-28
sp|Q9Y227|ENTP4_HUMAN Ectonucleoside triphosphate diphosphohydrolase 4 OS=Homo sapiens GN=ENTPD4 PE=1 SV=1 103 529 4.0E-27
sp|Q3TCT4|ENTP7_MOUSE Ectonucleoside triphosphate diphosphohydrolase 7 OS=Mus musculus GN=Entpd7 PE=2 SV=1 103 529 7.0E-27
sp|Q9MYU4|ENTP1_PIG Ectonucleoside triphosphate diphosphohydrolase 1 OS=Sus scrofa GN=ENTPD1 PE=1 SV=1 106 531 8.0E-27
sp|Q9NQZ7|ENTP7_HUMAN Ectonucleoside triphosphate diphosphohydrolase 7 OS=Homo sapiens GN=ENTPD7 PE=2 SV=1 103 529 3.0E-26
sp|Q9USP2|YND1_SCHPO Golgi apyrase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ynd1 PE=3 SV=1 113 505 7.0E-26
sp|Q28CF8|ENTP7_XENTR Ectonucleoside triphosphate diphosphohydrolase 7 OS=Xenopus tropicalis GN=entpd7 PE=2 SV=1 106 529 5.0E-24
sp|A0JND9|ENTP8_BOVIN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Bos taurus GN=ENTPD8 PE=2 SV=1 110 538 6.0E-21
sp|Q5MY95|ENTP8_HUMAN Ectonucleoside triphosphate diphosphohydrolase 8 OS=Homo sapiens GN=ENTPD8 PE=1 SV=2 112 531 6.0E-21
sp|F4JSH1|APY7_ARATH Probable apyrase 7 OS=Arabidopsis thaliana GN=APY7 PE=2 SV=1 113 529 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2014
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1343 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6018
Ophiocordyceps camponoti-floridani Ophcf2|06811
Ophiocordyceps camponoti-rufipedis Ophun1|1116
Ophiocordyceps kimflemingae Ophio5|5124
Ophiocordyceps subramaniannii Hirsu2|2268

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1343
MRRTSVSLPTKQVACDPHEKPDRYQLHNANLNRGLFANMKDAWLSQAQRTRWIKTAAIAFTLLTLFWWLSPRGVE
VYKEVSHTSATKGNVASDPSLGTTKCTKAYSKDKPLVQYVLMIDAGSTGSRIHVFKFNNCGAVPELETEEFKMTN
KAVGGLSKYKDDPVAAAQSLDTLMQHAMQHVPDKAKGCTPVAVKATAGLRLIGPEKSQAILDEVRRHLETDYPFP
VVSEEQNGVAVMDGALEGVYAWITTNYLLGKIGGPDKGATAAVFDLGGGSTQIVFEPTFKGAADGGMPETLAEGD
HKYSLDFGGRHFDLYQHSHLGYGLMSARKAIHKKLVADIDAKEKDSSWMSKPIVHPCIAPGMSTEVEVELDNQPT
ARTFNFTGPSQPAPAQCRNLAEKILLKDADCKLAPCSFNGIHQPSLAKTFSQEDVYIFSYFYDRTKPLGMPDSFT
LREMHDLTQTVCMGRDGWDVFTTMPDAMSELKDRPEHCLDLSFMMALLHTGYEMPIDREVKIAKKIKGNELGWCL
GASLPLLAPGSGWKCNIRQVS*
Coding >OphauG2|1343
ATGCGAAGAACGTCGGTCTCTCTGCCCACCAAACAAGTTGCTTGCGACCCTCACGAGAAACCTGATCGATATCAG
TTGCACAACGCCAATCTCAATCGCGGTTTATTTGCCAACATGAAGGACGCATGGCTGTCACAAGCTCAGCGGACG
CGCTGGATCAAGACGGCCGCCATTGCTTTTACGCTGCTTACTCTGTTTTGGTGGCTGTCACCTCGTGGAGTCGAA
GTATACAAGGAAGTATCTCACACCAGCGCCACCAAGGGCAATGTCGCGTCGGATCCGTCTCTGGGCACGACCAAG
TGCACCAAGGCATACTCCAAGGATAAGCCCCTTGTGCAGTATGTGCTCATGATTGACGCTGGGAGTACGGGATCC
CGCATTCACGTCTTCAAGTTTAACAATTGCGGTGCCGTCCCCGAGCTGGAGACGGAAGAATTCAAGATGACGAAC
AAGGCCGTTGGAGGACTGAGCAAATACAAGGACGACCCTGTTGCTGCCGCCCAGTCGCTGGACACCTTGATGCAA
CACGCGATGCAGCATGTCCCCGACAAGGCCAAGGGCTGCACTCCGGTGGCTGTCAAGGCCACGGCTGGTCTTCGC
CTCATTGGCCCAGAAAAATCACAGGCCATTCTCGATGAAGTCAGGCGGCACCTCGAGACTGACTATCCCTTCCCC
GTTGTCTCGGAAGAGCAAAACGGCGTTGCCGTCATGGATGGTGCCCTCGAGGGCGTCTATGCATGGATTACGACA
AACTACCTTCTTGGCAAGATTGGCGGCCCTGATAAGGGGGCCACGGCCGCAGTTTTTGACCTTGGCGGCGGCTCC
ACCCAGATTGTCTTTGAGCCCACCTTCAAGGGCGCTGCTGACGGAGGCATGCCCGAGACGCTTGCCGAGGGCGAT
CACAAGTATTCGCTTGATTTTGGGGGACGCCACTTTGACCTATACCAGCACTCTCATCTCGGCTACGGGTTGATG
TCGGCTCGCAAAGCTATCCACAAGAAACTTGTTGCGGATATTGATGCCAAGGAGAAGGACAGTTCATGGATGTCC
AAGCCCATTGTCCACCCTTGTATTGCGCCGGGCATGTCGACCGAAGTCGAGGTGGAGCTGGACAATCAACCGACT
GCGCGCACCTTTAACTTTACCGGCCCGTCGCAGCCCGCGCCCGCCCAGTGCCGCAACCTGGCTGAAAAGATTCTG
CTCAAAGACGCCGACTGCAAGCTGGCCCCTTGCTCCTTCAACGGCATCCATCAGCCATCGTTGGCCAAGACGTTT
TCCCAAGAGGATGTCTACATCTTTTCGTACTTTTACGACCGGACCAAGCCATTGGGCATGCCCGACTCCTTCACC
CTCCGCGAGATGCATGACCTGACGCAGACGGTGTGCATGGGCAGAGATGGCTGGGATGTCTTTACTACTATGCCT
GATGCTATGAGCGAGCTCAAGGACCGTCCCGAGCACTGCCTTGATCTGAGCTTCATGATGGCTCTGCTCCACACT
GGGTATGAGATGCCTATTGACCGCGAGGTCAAGATTGCCAAGAAGATCAAGGGCAATGAGTTGGGCTGGTGTCTT
GGTGCCAGCTTGCCTCTACTGGCCCCTGGATCCGGCTGGAAGTGCAACATTCGGCAAGTCTCTTAG
Transcript >OphauG2|1343
ATGCGAAGAACGTCGGTCTCTCTGCCCACCAAACAAGTTGCTTGCGACCCTCACGAGAAACCTGATCGATATCAG
TTGCACAACGCCAATCTCAATCGCGGTTTATTTGCCAACATGAAGGACGCATGGCTGTCACAAGCTCAGCGGACG
CGCTGGATCAAGACGGCCGCCATTGCTTTTACGCTGCTTACTCTGTTTTGGTGGCTGTCACCTCGTGGAGTCGAA
GTATACAAGGAAGTATCTCACACCAGCGCCACCAAGGGCAATGTCGCGTCGGATCCGTCTCTGGGCACGACCAAG
TGCACCAAGGCATACTCCAAGGATAAGCCCCTTGTGCAGTATGTGCTCATGATTGACGCTGGGAGTACGGGATCC
CGCATTCACGTCTTCAAGTTTAACAATTGCGGTGCCGTCCCCGAGCTGGAGACGGAAGAATTCAAGATGACGAAC
AAGGCCGTTGGAGGACTGAGCAAATACAAGGACGACCCTGTTGCTGCCGCCCAGTCGCTGGACACCTTGATGCAA
CACGCGATGCAGCATGTCCCCGACAAGGCCAAGGGCTGCACTCCGGTGGCTGTCAAGGCCACGGCTGGTCTTCGC
CTCATTGGCCCAGAAAAATCACAGGCCATTCTCGATGAAGTCAGGCGGCACCTCGAGACTGACTATCCCTTCCCC
GTTGTCTCGGAAGAGCAAAACGGCGTTGCCGTCATGGATGGTGCCCTCGAGGGCGTCTATGCATGGATTACGACA
AACTACCTTCTTGGCAAGATTGGCGGCCCTGATAAGGGGGCCACGGCCGCAGTTTTTGACCTTGGCGGCGGCTCC
ACCCAGATTGTCTTTGAGCCCACCTTCAAGGGCGCTGCTGACGGAGGCATGCCCGAGACGCTTGCCGAGGGCGAT
CACAAGTATTCGCTTGATTTTGGGGGACGCCACTTTGACCTATACCAGCACTCTCATCTCGGCTACGGGTTGATG
TCGGCTCGCAAAGCTATCCACAAGAAACTTGTTGCGGATATTGATGCCAAGGAGAAGGACAGTTCATGGATGTCC
AAGCCCATTGTCCACCCTTGTATTGCGCCGGGCATGTCGACCGAAGTCGAGGTGGAGCTGGACAATCAACCGACT
GCGCGCACCTTTAACTTTACCGGCCCGTCGCAGCCCGCGCCCGCCCAGTGCCGCAACCTGGCTGAAAAGATTCTG
CTCAAAGACGCCGACTGCAAGCTGGCCCCTTGCTCCTTCAACGGCATCCATCAGCCATCGTTGGCCAAGACGTTT
TCCCAAGAGGATGTCTACATCTTTTCGTACTTTTACGACCGGACCAAGCCATTGGGCATGCCCGACTCCTTCACC
CTCCGCGAGATGCATGACCTGACGCAGACGGTGTGCATGGGCAGAGATGGCTGGGATGTCTTTACTACTATGCCT
GATGCTATGAGCGAGCTCAAGGACCGTCCCGAGCACTGCCTTGATCTGAGCTTCATGATGGCTCTGCTCCACACT
GGGTATGAGATGCCTATTGACCGCGAGGTCAAGATTGCCAAGAAGATCAAGGGCAATGAGTTGGGCTGGTGTCTT
GGTGCCAGCTTGCCTCTACTGGCCCCTGGATCCGGCTGGAAGTGCAACATTCGGCAAGTCTCTTAG
Gene >OphauG2|1343
ATGCGAAGAACGTCGGTCTCTCTGCCCACCAAACAAGTTGCTTGCGACCCTCACGAGAAACCTGATCGATATCAG
TTGCACAACGCCAATCTCAATCGCGGTTTATTTGCCAACATGAAGGACGCATGGCTGTCACAAGCTCAGCGGACG
CGCTGGATCAAGACGGCCGCCATTGCTTTTACGCTGCTTACTCTGTTTTGGTGGCTGTCACCTCGTGGAGTCGAA
GTATACAAGGAAGGTTGGTTTGGCCGTGTTTTCCCCAAGGCTTCGCCGCTGTTCAAGGTGTCTGACGCGTCCCAG
TATCTCACACCAGCGCCACCAAGGGCAATGTCGCGTCGGATCCGTCTCTGGGCACGACCAAGTGCACCAAGGCAT
ACTCCAAGGATAAGCCCCTTGTGCAGTATGTGCTCATGATTGACGCTGGGAGTACGGGATCCCGCATTCACGTCT
TCAAGTTTAACAATTGCGGTGCCGTCCCCGAGCTGGAGACGGAAGAATTCAAGATGACGAACAAGGCCGTTGGAG
GACTGAGCAAATACAAGGACGACCCTGTTGCTGCCGCCCAGTCGCTGGACACCTTGATGCAACACGCGATGCAGC
ATGTCCCCGACAAGGCCAAGGGCTGCACTCCGGTGGCTGTCAAGGCCACGGCTGGTCTTCGCCTCATTGGCCCAG
AAAAATCACAGGCCATTCTCGATGAAGTCAGGCGGCACCTCGAGACTGACTATCCCTTCCCCGTTGTCTCGGAAG
AGCAAAACGGCGTTGCCGTCATGGATGGTGCCCTCGAGGGCGTCTATGCATGGATTACGACAAACTACCTTCTTG
GCAAGATTGGCGGCCCTGATAAGGGGGCCACGGCCGCAGTTTTTGACCTTGGCGGCGGCTCCACCCAGATTGTCT
TTGAGCCCACCTTCAAGGGCGCTGCTGACGGAGGCATGCCCGAGACGCTTGCCGAGGGCGATCACAAGTATTCGC
TTGATTTTGGGGGACGCCACTTTGACCTATACCAGCACTCTCATCTCGGCTACGGGTTGATGTCGGCTCGCAAAG
CTATCCACAAGAAACTTGTTGCGGATATTGATGCCAAGGAGAAGGACAGTTCATGGATGTCCAAGCCCATTGTCC
ACCCTTGTATTGCGCCGGGCATGTCGACCGAAGTCGAGGTGGAGCTGGACAATCAACCGACTGCGCGCACCTTTA
ACTTTACCGGCCCGTCGCAGCCCGCGCCCGCCCAGTGCCGCAACCTGGCTGAAAAGATTCTGCTCAAAGACGCCG
ACTGCAAGCTGGCCCCTTGCTCCTTCAACGGCATCCATCAGCCATCGTTGGCCAAGACGTTTTCCCAAGAGGATG
TCTACATCTTTTCGTACTTTTACGACCGGACCAAGCCATTGGGCATGCCCGACTCCTTCACCCTCCGCGAGATGC
ATGACCTGACGCAGACGGTGTGCATGGGCAGAGATGGCTGGGATGTCTTTACTACTATGCCTGATGCTATGAGCG
AGCTCAAGGACCGTCCCGAGCACTGCCTTGATCTGAGCTTCATGATGGCTCTGCTCCACACTGGGTATGAGATGC
CTATTGACCGCGAGGTCAAGATTGCCAAGAAGATCAAGGGCAATGAGTTGGGCTGGTGTCTTGGTGCCAGGTGAG
TTGTCTCTGAGTGGTCTCGGCCTGATTTTCGGGTTTGCCTCTCCAATGCTTCGAGTCCAAAGACTAACATTGAAA
ATCAGCTTGCCTCTACTGGCCCCTGGATCCGGCTGGAAGTGCAACATTCGGCAAGTCTCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail