Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1323
Gene name
LocationContig_1393:1294..3757
Strand-
Gene length (bp)2463
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01293 PEPCK_ATP Phosphoenolpyruvate carboxykinase 1.2E-215 66 531

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVS9|PCKA_NEUCR Phosphoenolpyruvate carboxykinase [ATP] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-6 PE=3 SV=2 30 580 0.0E+00
sp|Q96UL8|PCKA_EMENI Phosphoenolpyruvate carboxykinase [ATP] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuF PE=3 SV=3 20 580 0.0E+00
sp|O43112|PCKA_KLULA Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PCK1 PE=3 SV=2 40 580 0.0E+00
sp|Q753M0|PCKA_ASHGO Phosphoenolpyruvate carboxykinase [ATP] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PCK1 PE=3 SV=1 40 580 0.0E+00
sp|Q6FRR0|PCKA_CANGA Phosphoenolpyruvate carboxykinase [ATP] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PCK1 PE=3 SV=1 49 580 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVS9|PCKA_NEUCR Phosphoenolpyruvate carboxykinase [ATP] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-6 PE=3 SV=2 30 580 0.0E+00
sp|Q96UL8|PCKA_EMENI Phosphoenolpyruvate carboxykinase [ATP] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuF PE=3 SV=3 20 580 0.0E+00
sp|O43112|PCKA_KLULA Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PCK1 PE=3 SV=2 40 580 0.0E+00
sp|Q753M0|PCKA_ASHGO Phosphoenolpyruvate carboxykinase [ATP] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PCK1 PE=3 SV=1 40 580 0.0E+00
sp|Q6FRR0|PCKA_CANGA Phosphoenolpyruvate carboxykinase [ATP] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PCK1 PE=3 SV=1 49 580 0.0E+00
sp|P10963|PCKA_YEAST Phosphoenolpyruvate carboxykinase [ATP] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCK1 PE=1 SV=2 47 578 0.0E+00
sp|O13434|PCKA_CANAX Phosphoenolpyruvate carboxykinase [ATP] OS=Candida albicans GN=PCK1 PE=3 SV=1 75 578 0.0E+00
sp|Q75JD5|PCKA_DICDI Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyostelium discoideum GN=pckA PE=1 SV=1 66 580 0.0E+00
sp|Q2S008|PCKA2_SALRD Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pckA2 PE=3 SV=1 59 580 0.0E+00
sp|Q9T074|PCKA_ARATH Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1 66 578 0.0E+00
sp|P42066|PCKA_CUCSA Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis sativus GN=PCK PE=2 SV=1 66 580 0.0E+00
sp|Q9XFA2|PCKA2_UROPA Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1 66 578 0.0E+00
sp|Q9SLZ0|PCKA_MAIZE Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1 66 578 0.0E+00
sp|P49292|PCKA1_UROPA Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1 66 578 0.0E+00
sp|A7GU41|PCKA_BACCN Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pckA PE=3 SV=1 71 579 8.0E-180
sp|A9VLC7|PCKA_BACWK Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus weihenstephanensis (strain KBAB4) GN=pckA PE=3 SV=1 71 578 9.0E-180
sp|B7IL29|PCKA_BACC2 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain G9842) GN=pckA PE=3 SV=1 71 577 6.0E-178
sp|C0ZL09|PCKA_BREBN Phosphoenolpyruvate carboxykinase [ATP] OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pckA PE=3 SV=1 69 580 8.0E-177
sp|Q6HCB3|PCKA_BACHK Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pckA PE=3 SV=1 71 577 2.0E-176
sp|B9J266|PCKA_BACCQ Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain Q1) GN=pckA PE=3 SV=1 71 577 2.0E-176
sp|B7HSV7|PCKA_BACC7 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain AH187) GN=pckA PE=3 SV=1 71 577 2.0E-176
sp|Q72YV4|PCKA_BACC1 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pckA PE=3 SV=1 71 577 6.0E-176
sp|Q632S4|PCKA_BACCZ Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain ZK / E33L) GN=pckA PE=3 SV=1 71 577 6.0E-176
sp|Q816Q7|PCKA_BACCR Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pckA PE=3 SV=1 71 577 6.0E-176
sp|C1EW38|PCKA_BACC3 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain 03BB102) GN=pckA PE=3 SV=1 71 577 6.0E-176
sp|B7JT33|PCKA_BACC0 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain AH820) GN=pckA PE=3 SV=1 71 577 6.0E-176
sp|A0RJZ8|PCKA_BACAH Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus thuringiensis (strain Al Hakam) GN=pckA PE=3 SV=1 71 577 6.0E-176
sp|Q81KH8|PCKA_BACAN Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus anthracis GN=pckA PE=3 SV=1 71 577 1.0E-175
sp|C3PCC6|PCKA_BACAA Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus anthracis (strain A0248) GN=pckA PE=3 SV=1 71 577 1.0E-175
sp|B7H9C8|PCKA_BACC4 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus cereus (strain B4264) GN=pckA PE=3 SV=1 71 577 4.0E-175
sp|Q8R943|PCKA_CALS4 Phosphoenolpyruvate carboxykinase [ATP] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pckA PE=3 SV=1 69 578 6.0E-175
sp|Q8EP04|PCKA_OCEIH Phosphoenolpyruvate carboxykinase [ATP] OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pckA PE=3 SV=1 69 578 6.0E-174
sp|Q5KW01|PCKA_GEOKA Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacillus kaustophilus (strain HTA426) GN=pckA PE=3 SV=1 71 565 5.0E-171
sp|A4IRZ2|PCKA_GEOTN Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pckA PE=3 SV=1 71 565 1.0E-169
sp|Q2RH96|PCKA2_MOOTA Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Moorella thermoacetica (strain ATCC 39073) GN=pckA2 PE=3 SV=1 66 580 2.0E-169
sp|B1HXZ6|PCKA_LYSSC Phosphoenolpyruvate carboxykinase [ATP] OS=Lysinibacillus sphaericus (strain C3-41) GN=pckA PE=3 SV=1 88 578 2.0E-168
sp|Q5HNB7|PCKA_STAEQ Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pckA PE=3 SV=1 71 569 6.0E-168
sp|Q2RKS7|PCKA1_MOOTA Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=pckA1 PE=3 SV=1 66 566 1.0E-167
sp|P54418|PCKA_BACSU Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus subtilis (strain 168) GN=pckA PE=3 SV=3 69 577 1.0E-167
sp|Q8CS25|PCKA_STAES Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pckA PE=3 SV=1 71 569 3.0E-167
sp|Q9K7Q7|PCKA_BACHD Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pckA PE=3 SV=1 66 580 3.0E-167
sp|B9DN20|PCKA_STACT Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus carnosus (strain TM300) GN=pckA PE=3 SV=1 88 577 6.0E-167
sp|Q1IZ41|PCKA_DEIGD Phosphoenolpyruvate carboxykinase [ATP] OS=Deinococcus geothermalis (strain DSM 11300) GN=pckA PE=3 SV=1 69 566 6.0E-166
sp|A5GBF9|PCKA_GEOUR Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacter uraniireducens (strain Rf4) GN=pckA PE=3 SV=1 70 573 1.0E-165
sp|A8FGH8|PCKA_BACP2 Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus pumilus (strain SAFR-032) GN=pckA PE=3 SV=1 48 580 3.0E-165
sp|Q72GY7|PCKA_THET2 Phosphoenolpyruvate carboxykinase [ATP] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pckA PE=3 SV=1 75 578 4.0E-163
sp|Q6GFR5|PCKA_STAAR Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain MRSA252) GN=pckA PE=3 SV=1 71 577 4.0E-163
sp|Q2YTK0|PCKA_STAAB Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|P0C1S4|PCKA_STAAU Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|A8Z4L3|PCKA_STAAT Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|P99128|PCKA_STAAN Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain N315) GN=pckA PE=1 SV=1 71 577 6.0E-163
sp|P0A0B3|PCKA_STAAM Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|A6QHX1|PCKA_STAAE Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain Newman) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|Q5HEY8|PCKA_STAAC Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain COL) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|A5ITV7|PCKA_STAA9 Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain JH9) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|Q2G1W2|PCKA_STAA8 Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain NCTC 8325) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|Q2FFV5|PCKA_STAA3 Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain USA300) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|A6U2Q2|PCKA_STAA2 Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain JH1) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|A7X3N3|PCKA_STAA1 Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pckA PE=3 SV=1 71 577 6.0E-163
sp|Q4L7C9|PCKA_STAHJ Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pckA PE=3 SV=1 88 571 7.0E-163
sp|Q8NVZ8|PCKA_STAAW Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain MW2) GN=pckA PE=3 SV=1 71 577 7.0E-163
sp|Q6G8E2|PCKA_STAAS Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus aureus (strain MSSA476) GN=pckA PE=3 SV=1 71 577 7.0E-163
sp|Q5SLL5|PCKA_THET8 Phosphoenolpyruvate carboxykinase [ATP] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pckA PE=1 SV=1 75 578 2.0E-162
sp|A5FK68|PCKA_FLAJ1 Phosphoenolpyruvate carboxykinase [ATP] OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pckA PE=3 SV=1 79 578 3.0E-162
sp|Q49YL7|PCKA_STAS1 Phosphoenolpyruvate carboxykinase [ATP] OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pckA PE=3 SV=1 71 577 3.0E-162
sp|B3ET45|PCKA_AMOA5 Phosphoenolpyruvate carboxykinase [ATP] OS=Amoebophilus asiaticus (strain 5a2) GN=pckA PE=3 SV=1 72 565 7.0E-162
sp|A7Z7Z0|PCKA_BACMF Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pckA PE=3 SV=1 69 577 2.0E-161
sp|A6Q102|PCKA_NITSB Phosphoenolpyruvate carboxykinase [ATP] OS=Nitratiruptor sp. (strain SB155-2) GN=pckA PE=3 SV=1 69 580 2.0E-160
sp|B0SPF0|PCKA_LEPBP Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pckA PE=3 SV=1 66 578 4.0E-160
sp|B0SFJ3|PCKA_LEPBA Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pckA PE=3 SV=1 66 578 4.0E-160
sp|Q65FV7|PCKA_BACLD Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pckA PE=3 SV=1 69 577 6.0E-160
sp|Q1AY78|PCKA_RUBXD Phosphoenolpyruvate carboxykinase [ATP] OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pckA PE=3 SV=1 88 580 8.0E-160
sp|A1AV24|PCKA_PELPD Phosphoenolpyruvate carboxykinase [ATP] OS=Pelobacter propionicus (strain DSM 2379) GN=pckA PE=3 SV=1 70 576 2.0E-159
sp|A9M9S3|PCKA_BRUC2 Phosphoenolpyruvate carboxykinase [ATP] OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pckA PE=3 SV=1 65 580 5.0E-159
sp|Q8FY05|PCKA_BRUSU Phosphoenolpyruvate carboxykinase [ATP] OS=Brucella suis biovar 1 (strain 1330) GN=pckA PE=3 SV=1 65 580 5.0E-159
sp|P51058|PCKA_TRYCR Phosphoenolpyruvate carboxykinase [ATP], glycosomal OS=Trypanosoma cruzi GN=PEPCK PE=1 SV=1 75 515 1.0E-158
sp|P13735|PCKA_TRYBB Phosphoenolpyruvate carboxykinase [ATP], glycosomal OS=Trypanosoma brucei brucei PE=3 SV=1 66 528 2.0E-158
sp|A8MEV2|PCKA_ALKOO Phosphoenolpyruvate carboxykinase [ATP] OS=Alkaliphilus oremlandii (strain OhILAs) GN=pckA PE=3 SV=1 81 580 3.0E-158
sp|Q8YE41|PCKA_BRUME Phosphoenolpyruvate carboxykinase [ATP] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pckA PE=3 SV=2 65 580 3.0E-158
sp|A0LXJ9|PCKA_GRAFK Phosphoenolpyruvate carboxykinase [ATP] OS=Gramella forsetii (strain KT0803) GN=pckA PE=3 SV=1 89 578 5.0E-158
sp|A6WX47|PCKA_OCHA4 Phosphoenolpyruvate carboxykinase [ATP] OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pckA PE=3 SV=1 65 580 2.0E-157
sp|B3Q999|PCKA_RHOPT Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain TIE-1) GN=pckA PE=3 SV=1 75 580 4.0E-157
sp|Q9ZNH4|PCKA_RHOPA Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pckA PE=1 SV=2 75 580 2.0E-156
sp|Q8F9E4|PCKA_LEPIN Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pckA PE=3 SV=1 86 580 3.0E-156
sp|Q72VT0|PCKA_LEPIC Phosphoenolpyruvate carboxykinase [ATP] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pckA PE=3 SV=1 86 580 3.0E-156
sp|Q8UJ94|PCKA_AGRFC Phosphoenolpyruvate carboxykinase [ATP] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pckA PE=3 SV=2 69 578 7.0E-156
sp|Q5WDZ7|PCKA_BACSK Phosphoenolpyruvate carboxykinase [ATP] OS=Bacillus clausii (strain KSM-K16) GN=pckA PE=3 SV=1 73 578 9.0E-156
sp|Q5LVJ2|PCKA_RUEPO Phosphoenolpyruvate carboxykinase [ATP] OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pckA PE=3 SV=1 74 573 1.0E-155
sp|A8LLF2|PCKA_DINSH Phosphoenolpyruvate carboxykinase [ATP] OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pckA PE=3 SV=1 74 573 2.0E-155
sp|A1B5Z2|PCKA_PARDP Phosphoenolpyruvate carboxykinase [ATP] OS=Paracoccus denitrificans (strain Pd 1222) GN=pckA PE=3 SV=1 78 576 3.0E-155
sp|Q2G480|PCKA_NOVAD Phosphoenolpyruvate carboxykinase [ATP] OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pckA PE=3 SV=1 66 578 6.0E-155
sp|Q21BR2|PCKA_RHOPB Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain BisB18) GN=pckA PE=3 SV=1 69 578 7.0E-155
sp|Q2J2Y8|PCKA_RHOP2 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain HaA2) GN=pckA PE=3 SV=1 69 580 2.0E-154
sp|Q07TF9|PCKA_RHOP5 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain BisA53) GN=pckA PE=3 SV=1 69 578 2.0E-154
sp|P43085|PCKA_RHIME Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium meliloti (strain 1021) GN=pckA PE=3 SV=1 69 578 3.0E-154
sp|P43086|PCKA_RHISN Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium sp. (strain NGR234) GN=pckA PE=3 SV=2 59 578 6.0E-154
sp|B9KD79|PCKA_CAMLR Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=pckA PE=3 SV=1 76 580 7.0E-154
sp|A4YL90|PCKA_BRASO Phosphoenolpyruvate carboxykinase [ATP] OS=Bradyrhizobium sp. (strain ORS278) GN=pckA PE=3 SV=1 69 580 1.0E-153
sp|Q3J5V6|PCKA_RHOS4 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pckA PE=3 SV=1 93 576 2.0E-153
sp|A3PGG3|PCKA_RHOS1 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pckA PE=3 SV=1 93 576 2.0E-153
sp|B9JXX4|PCKA_AGRVS Phosphoenolpyruvate carboxykinase [ATP] OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pckA PE=3 SV=1 53 580 2.0E-153
sp|Q11CK2|PCKA_CHESB Phosphoenolpyruvate carboxykinase [ATP] OS=Chelativorans sp. (strain BNC1) GN=pckA PE=3 SV=1 75 580 3.0E-153
sp|A5EST5|PCKA_BRASB Phosphoenolpyruvate carboxykinase [ATP] OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pckA PE=3 SV=1 69 580 3.0E-153
sp|Q2KE66|PCKA_RHIEC Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pckA PE=3 SV=1 69 580 4.0E-153
sp|Q13E86|PCKA_RHOPS Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodopseudomonas palustris (strain BisB5) GN=pckA PE=3 SV=1 75 580 5.0E-153
sp|A4WVP0|PCKA_RHOS5 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pckA PE=3 SV=1 93 576 5.0E-153
sp|Q1MNG2|PCKA_RHIL3 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pckA PE=3 SV=1 69 580 1.0E-152
sp|Q39QU2|PCKA_GEOMG Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pckA PE=3 SV=1 47 575 2.0E-152
sp|A7HP99|PCKA_PARL1 Phosphoenolpyruvate carboxykinase [ATP] OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pckA PE=3 SV=1 73 573 3.0E-152
sp|Q98CL7|PCKA_RHILO Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium loti (strain MAFF303099) GN=pckA PE=3 SV=1 69 578 5.0E-152
sp|Q89BK7|PCKA_BRADU Phosphoenolpyruvate carboxykinase [ATP] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pckA PE=3 SV=1 69 580 6.0E-152
sp|A6UEJ7|PCKA_SINMW Phosphoenolpyruvate carboxykinase [ATP] OS=Sinorhizobium medicae (strain WSM419) GN=pckA PE=3 SV=1 69 578 9.0E-152
sp|Q30PV8|PCKA_SULDN Phosphoenolpyruvate carboxykinase [ATP] OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pckA PE=3 SV=1 88 580 1.0E-151
sp|B3PWH4|PCKA_RHIE6 Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium etli (strain CIAT 652) GN=pckA PE=3 SV=1 69 580 5.0E-151
sp|Q16AH6|PCKA_ROSDO Phosphoenolpyruvate carboxykinase [ATP] OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pckA PE=3 SV=1 87 576 1.0E-150
sp|B5ZV86|PCKA_RHILW Phosphoenolpyruvate carboxykinase [ATP] OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pckA PE=3 SV=1 69 580 2.0E-150
sp|Q47VD0|PCKA_COLP3 Phosphoenolpyruvate carboxykinase [ATP] OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pckA PE=3 SV=1 66 580 3.0E-149
sp|Q1GDU2|PCKA_RUEST Phosphoenolpyruvate carboxykinase [ATP] OS=Ruegeria sp. (strain TM1040) GN=pckA PE=3 SV=1 74 576 4.0E-149
sp|B4F025|PCKA_PROMH Phosphoenolpyruvate carboxykinase [ATP] OS=Proteus mirabilis (strain HI4320) GN=pckA PE=3 SV=1 61 578 5.0E-149
sp|B7LSA4|PCKA_ESCF3 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pckA PE=3 SV=1 66 580 6.0E-149
sp|B6JJT0|PCKA_OLICO Phosphoenolpyruvate carboxykinase [ATP] OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pckA PE=3 SV=1 69 574 6.0E-149
sp|C6E0Y2|PCKA_GEOSM Phosphoenolpyruvate carboxykinase [ATP] OS=Geobacter sp. (strain M21) GN=pckA PE=3 SV=1 73 573 1.0E-148
sp|A9MMC5|PCKA_SALAR Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pckA PE=3 SV=1 66 580 1.0E-148
sp|A8ILP8|PCKA_AZOC5 Phosphoenolpyruvate carboxykinase [ATP] OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pckA PE=3 SV=1 98 580 1.0E-148
sp|A8FLY1|PCKA_CAMJ8 Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=pckA PE=3 SV=1 89 580 2.0E-148
sp|A8AQV7|PCKA_CITK8 Phosphoenolpyruvate carboxykinase [ATP] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pckA PE=3 SV=1 66 580 2.0E-148
sp|A4WFJ1|PCKA_ENT38 Phosphoenolpyruvate carboxykinase [ATP] OS=Enterobacter sp. (strain 638) GN=pckA PE=3 SV=1 66 578 2.0E-148
sp|A1VZR5|PCKA_CAMJJ Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pckA PE=3 SV=1 89 580 2.0E-148
sp|B1LHK1|PCKA_ECOSM Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pckA PE=3 SV=1 66 580 2.0E-148
sp|B7NMG6|PCKA_ECO7I Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pckA PE=3 SV=1 66 580 2.0E-148
sp|Q8FCU4|PCKA_ECOL6 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pckA PE=3 SV=2 66 580 3.0E-148
sp|Q4QM91|PCKA_HAEI8 Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus influenzae (strain 86-028NP) GN=pckA PE=3 SV=1 47 578 3.0E-148
sp|A5UHW1|PCKA_HAEIG Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus influenzae (strain PittGG) GN=pckA PE=3 SV=1 47 578 4.0E-148
sp|B7NE08|PCKA_ECOLU Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pckA PE=3 SV=1 66 580 4.0E-148
sp|A1AGS9|PCKA_ECOK1 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O1:K1 / APEC GN=pckA PE=3 SV=1 66 580 4.0E-148
sp|B7N136|PCKA_ECO81 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O81 (strain ED1a) GN=pckA PE=3 SV=1 66 580 4.0E-148
sp|B7MDM9|PCKA_ECO45 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pckA PE=3 SV=1 66 580 4.0E-148
sp|B6I2W3|PCKA_ECOSE Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain SE11) GN=pckA PE=3 SV=1 66 580 5.0E-148
sp|Q0TC64|PCKA_ECOL5 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pckA PE=3 SV=1 66 580 5.0E-148
sp|A7ZST1|PCKA_ECO24 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pckA PE=3 SV=1 66 580 5.0E-148
sp|Q0SZR5|PCKA_SHIF8 Phosphoenolpyruvate carboxykinase [ATP] OS=Shigella flexneri serotype 5b (strain 8401) GN=pckA PE=3 SV=1 66 580 5.0E-148
sp|C4ZBL1|PCKA_EUBR3 Phosphoenolpyruvate carboxykinase [ATP] OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=pckA PE=3 SV=1 66 580 5.0E-148
sp|Q83J96|PCKA_SHIFL Phosphoenolpyruvate carboxykinase [ATP] OS=Shigella flexneri GN=pckA PE=3 SV=4 66 580 5.0E-148
sp|A7H3B9|PCKA_CAMJD Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pckA PE=3 SV=1 89 580 6.0E-148
sp|Q3YWM2|PCKA_SHISS Phosphoenolpyruvate carboxykinase [ATP] OS=Shigella sonnei (strain Ss046) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|Q31VN1|PCKA_SHIBS Phosphoenolpyruvate carboxykinase [ATP] OS=Shigella boydii serotype 4 (strain Sb227) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|B2U3L1|PCKA_SHIB3 Phosphoenolpyruvate carboxykinase [ATP] OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|P22259|PCKA_ECOLI Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain K12) GN=pckA PE=1 SV=2 66 580 6.0E-148
sp|B1IP62|PCKA_ECOLC Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|A8A5L1|PCKA_ECOHS Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O9:H4 (strain HS) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|B1X750|PCKA_ECODH Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain K12 / DH10B) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|C4ZUQ8|PCKA_ECOBW Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|B7M1V7|PCKA_ECO8A Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O8 (strain IAI1) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|B7L4T1|PCKA_ECO55 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli (strain 55989 / EAEC) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|B7UKA7|PCKA_ECO27 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|A1JSE7|PCKA_YERE8 Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pckA PE=3 SV=1 66 580 6.0E-148
sp|A6VKV4|PCKA_ACTSZ Phosphoenolpyruvate carboxykinase [ATP] OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pckA PE=1 SV=1 45 578 9.0E-148
sp|B2VJU9|PCKA_ERWT9 Phosphoenolpyruvate carboxykinase [ATP] OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pckA PE=3 SV=1 62 580 1.0E-147
sp|A7FNU8|PCKA_YERP3 Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pckA PE=3 SV=1 66 580 1.0E-147
sp|B5R7L4|PCKA_SALG2 Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pckA PE=3 SV=1 66 580 1.0E-147
sp|B0UWS7|PCKA_HISS2 Phosphoenolpyruvate carboxykinase [ATP] OS=Histophilus somni (strain 2336) GN=pckA PE=3 SV=1 47 578 1.0E-147
sp|Q0I554|PCKA_HAES1 Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus somnus (strain 129Pt) GN=pckA PE=3 SV=1 47 578 1.0E-147
sp|A5UDR5|PCKA_HAEIE Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus influenzae (strain PittEE) GN=pckA PE=3 SV=1 47 578 2.0E-147
sp|Q2S1I3|PCKA1_SALRD Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pckA1 PE=3 SV=1 75 580 2.0E-147
sp|B1JI04|PCKA_YERPY Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|Q664K7|PCKA_YERPS Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|A4TGS8|PCKA_YERPP Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pestis (strain Pestoides F) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|Q1CCM6|PCKA_YERPN Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|Q8ZJG9|PCKA_YERPE Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pestis GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B2K5U8|PCKA_YERPB Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|Q1C2M9|PCKA_YERPA Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|Q8Z216|PCKA_SALTI Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella typhi GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B4TY59|PCKA_SALSV Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella schwarzengrund (strain CVM19633) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B5BHF8|PCKA_SALPK Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella paratyphi A (strain AKU_12601) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|C0Q0H5|PCKA_SALPC Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella paratyphi C (strain RKS4594) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|A9MT72|PCKA_SALPB Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|Q5PLX8|PCKA_SALPA Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B4SVK3|PCKA_SALNS Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella newport (strain SL254) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B4TKS6|PCKA_SALHS Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella heidelberg (strain SL476) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B5R360|PCKA_SALEP Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella enteritidis PT4 (strain P125109) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B5FJS1|PCKA_SALDC Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella dublin (strain CT_02021853) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B5F8L6|PCKA_SALA4 Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella agona (strain SL483) GN=pckA PE=3 SV=1 66 580 2.0E-147
sp|B5YTV3|PCKA_ECO5E Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pckA PE=3 SV=1 66 580 3.0E-147
sp|Q8X733|PCKA_ECO57 Phosphoenolpyruvate carboxykinase [ATP] OS=Escherichia coli O157:H7 GN=pckA PE=3 SV=1 66 580 3.0E-147
sp|P43923|PCKA_HAEIN Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pckA PE=3 SV=1 47 578 4.0E-147
sp|Q57IX4|PCKA_SALCH Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella choleraesuis (strain SC-B67) GN=pckA PE=3 SV=1 66 580 5.0E-147
sp|Q32AL7|PCKA_SHIDS Phosphoenolpyruvate carboxykinase [ATP] OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pckA PE=3 SV=1 66 580 5.0E-147
sp|Q5HUM7|PCKA_CAMJR Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter jejuni (strain RM1221) GN=pckA PE=3 SV=1 89 580 6.0E-147
sp|B6EGP7|PCKA_ALISL Phosphoenolpyruvate carboxykinase [ATP] OS=Aliivibrio salmonicida (strain LFI1238) GN=pckA PE=3 SV=1 40 580 6.0E-147
sp|C5BGS4|PCKA_EDWI9 Phosphoenolpyruvate carboxykinase [ATP] OS=Edwardsiella ictaluri (strain 93-146) GN=pckA PE=3 SV=1 62 578 7.0E-147
sp|B8IMT2|PCKA_METNO Phosphoenolpyruvate carboxykinase [ATP] OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=pckA PE=3 SV=1 69 580 7.0E-147
sp|Q6LLS2|PCKA_PHOPR Phosphoenolpyruvate carboxykinase [ATP] OS=Photobacterium profundum GN=pckA PE=3 SV=1 66 580 9.0E-147
sp|B9JG59|PCKA_AGRRK Phosphoenolpyruvate carboxykinase [ATP] OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pckA PE=3 SV=1 75 578 9.0E-147
sp|Q5QUN4|PCKA_IDILO Phosphoenolpyruvate carboxykinase [ATP] OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pckA PE=3 SV=1 66 580 1.0E-146
sp|Q9PP01|PCKA_CAMJE Phosphoenolpyruvate carboxykinase [ATP] OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pckA PE=3 SV=1 89 580 1.0E-146
sp|A9R4C2|PCKA_YERPG Phosphoenolpyruvate carboxykinase [ATP] OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pckA PE=3 SV=1 66 580 2.0E-146
sp|A7MGC5|PCKA_CROS8 Phosphoenolpyruvate carboxykinase [ATP] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pckA PE=3 SV=1 62 578 2.0E-146
sp|Q8REI2|PCKA_FUSNN Phosphoenolpyruvate carboxykinase [ATP] OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pckA PE=3 SV=2 69 578 4.0E-146
sp|B1M6N5|PCKA_METRJ Phosphoenolpyruvate carboxykinase [ATP] OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=pckA PE=3 SV=1 75 579 5.0E-146
sp|Q3SVS4|PCKA_NITWN Phosphoenolpyruvate carboxykinase [ATP] OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pckA PE=3 SV=1 65 578 1.0E-145
sp|B3H1D9|PCKA_ACTP7 Phosphoenolpyruvate carboxykinase [ATP] OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pckA PE=3 SV=1 49 580 2.0E-145
sp|B0BP80|PCKA_ACTPJ Phosphoenolpyruvate carboxykinase [ATP] OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pckA PE=3 SV=1 49 580 2.0E-145
sp|A3N0G0|PCKA_ACTP2 Phosphoenolpyruvate carboxykinase [ATP] OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pckA PE=3 SV=1 49 580 2.0E-145
sp|C4Z0Q6|PCKA_EUBE2 Phosphoenolpyruvate carboxykinase [ATP] OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=pckA PE=3 SV=1 66 580 2.0E-145
sp|Q1QR12|PCKA_NITHX Phosphoenolpyruvate carboxykinase [ATP] OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pckA PE=3 SV=1 65 573 3.0E-145
sp|P41033|PCKA_SALTY Phosphoenolpyruvate carboxykinase [ATP] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pckA PE=3 SV=2 66 580 4.0E-145
sp|Q7VLT3|PCKA_HAEDU Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pckA PE=3 SV=1 66 580 7.0E-145
sp|A7MZB2|PCKA_VIBCB Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pckA PE=3 SV=1 66 580 8.0E-145
sp|Q87TE1|PCKA_VIBPA Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pckA PE=3 SV=1 66 580 1.0E-144
sp|B8F4W1|PCKA_HAEPS Phosphoenolpyruvate carboxykinase [ATP] OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pckA PE=3 SV=1 66 580 3.0E-144
sp|Q6CZP5|PCKA_PECAS Phosphoenolpyruvate carboxykinase [ATP] OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pckA PE=3 SV=1 56 578 4.0E-144
sp|Q7MQ03|PCKA_VIBVY Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio vulnificus (strain YJ016) GN=pckA PE=3 SV=1 66 580 9.0E-144
sp|Q8DDS6|PCKA_VIBVU Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio vulnificus (strain CMCP6) GN=pckA PE=3 SV=1 66 580 1.0E-143
sp|C6DGE8|PCKA_PECCP Phosphoenolpyruvate carboxykinase [ATP] OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pckA PE=3 SV=1 56 578 1.0E-143
sp|C3LSG5|PCKA_VIBCM Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pckA PE=3 SV=1 52 580 2.0E-143
sp|Q9KNK0|PCKA_VIBCH Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pckA PE=3 SV=3 52 580 2.0E-143
sp|A5F4Q4|PCKA_VIBC3 Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pckA PE=3 SV=1 52 580 2.0E-143
sp|B5FCE7|PCKA_VIBFM Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio fischeri (strain MJ11) GN=pckA PE=3 SV=1 66 580 2.0E-143
sp|B0UFE2|PCKA_METS4 Phosphoenolpyruvate carboxykinase [ATP] OS=Methylobacterium sp. (strain 4-46) GN=pckA PE=3 SV=1 69 580 2.0E-143
sp|Q5E1X3|PCKA_VIBF1 Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pckA PE=3 SV=2 66 580 3.0E-143
sp|Q7NA45|PCKA_PHOLL Phosphoenolpyruvate carboxykinase [ATP] OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pckA PE=3 SV=1 61 580 3.0E-143
sp|Q65Q60|PCKA_MANSM Phosphoenolpyruvate carboxykinase [ATP] OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pckA PE=3 SV=1 47 578 9.0E-143
sp|Q9CKR4|PCKA_PASMU Phosphoenolpyruvate carboxykinase [ATP] OS=Pasteurella multocida (strain Pm70) GN=pckA PE=3 SV=1 47 578 2.0E-142
sp|A9W382|PCKA_METEP Phosphoenolpyruvate carboxykinase [ATP] OS=Methylobacterium extorquens (strain PA1) GN=pckA PE=3 SV=1 62 573 5.0E-142
sp|B7KVW8|PCKA_METC4 Phosphoenolpyruvate carboxykinase [ATP] OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pckA PE=3 SV=1 62 573 5.0E-142
sp|B1ZG99|PCKA_METPB Phosphoenolpyruvate carboxykinase [ATP] OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pckA PE=3 SV=1 62 578 6.0E-141
sp|A1S1X0|PCKA_SHEAM Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pckA PE=3 SV=1 69 578 9.0E-141
sp|B7VHF2|PCKA_VIBTL Phosphoenolpyruvate carboxykinase [ATP] OS=Vibrio tasmaniensis (strain LGP32) GN=pckA PE=3 SV=1 66 580 2.0E-140
sp|Q9RVP6|PCKA_DEIRA Phosphoenolpyruvate carboxykinase [ATP] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pckA PE=3 SV=2 69 496 3.0E-139
sp|O83023|PCKA_SELRU Phosphoenolpyruvate carboxykinase [ATP] OS=Selenomonas ruminantium GN=pckA PE=3 SV=1 65 580 4.0E-139
sp|Q0I0F2|PCKA_SHESR Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella sp. (strain MR-7) GN=pckA PE=3 SV=1 69 578 6.0E-139
sp|A3DAB2|PCKA_SHEB5 Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pckA PE=3 SV=1 69 578 2.0E-138
sp|A6WHM7|PCKA_SHEB8 Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella baltica (strain OS185) GN=pckA PE=3 SV=1 69 578 2.0E-138
sp|A9KVC7|PCKA_SHEB9 Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella baltica (strain OS195) GN=pckA PE=3 SV=1 69 578 2.0E-138
sp|Q2NQI3|PCKA_SODGM Phosphoenolpyruvate carboxykinase [ATP] OS=Sodalis glossinidius (strain morsitans) GN=pckA PE=3 SV=1 66 578 2.0E-138
sp|Q12T12|PCKA_SHEDO Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pckA PE=3 SV=1 69 578 3.0E-138
sp|Q0HNY4|PCKA_SHESM Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella sp. (strain MR-4) GN=pckA PE=3 SV=1 69 578 3.0E-138
sp|A1U754|PCKA_MARHV Phosphoenolpyruvate carboxykinase [ATP] OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pckA PE=3 SV=1 71 578 3.0E-138
sp|A4YBE7|PCKA_SHEPC Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pckA PE=3 SV=1 69 578 4.0E-138
sp|A1RPC2|PCKA_SHESW Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella sp. (strain W3-18-1) GN=pckA PE=3 SV=1 69 578 6.0E-138
sp|Q0AQP4|PCKA_MARMM Phosphoenolpyruvate carboxykinase [ATP] OS=Maricaulis maris (strain MCS10) GN=pckA PE=3 SV=1 75 580 6.0E-138
sp|B8E3X7|PCKA_SHEB2 Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella baltica (strain OS223) GN=pckA PE=3 SV=1 69 578 9.0E-138
sp|Q8EKD3|PCKA_SHEON Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella oneidensis (strain MR-1) GN=pckA PE=3 SV=1 69 578 1.0E-137
sp|A3QJ41|PCKA_SHELP Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pckA PE=3 SV=1 69 578 2.0E-137
sp|B1KN33|PCKA_SHEWM Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pckA PE=3 SV=1 69 578 3.0E-137
sp|B6YRN4|PCKA_AZOPC Phosphoenolpyruvate carboxykinase [ATP] OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=pckA PE=3 SV=1 62 580 3.0E-137
sp|A0KRH2|PCKA_SHESA Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella sp. (strain ANA-3) GN=pckA PE=3 SV=1 69 578 5.0E-137
sp|C4K3J5|PCKA_HAMD5 Phosphoenolpyruvate carboxykinase [ATP] OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pckA PE=3 SV=1 66 578 2.0E-136
sp|B8CH32|PCKA_SHEPW Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pckA PE=3 SV=1 69 578 3.0E-136
sp|A8G1J1|PCKA_SHESH Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella sediminis (strain HAW-EB3) GN=pckA PE=3 SV=1 69 578 5.0E-136
sp|A8GYT2|PCKA_SHEPA Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pckA PE=3 SV=1 69 578 2.0E-135
sp|Q7MU78|PCKA_PORGI Phosphoenolpyruvate carboxykinase [ATP] OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pckA PE=3 SV=1 66 580 2.0E-135
sp|Q089V1|PCKA_SHEFN Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella frigidimarina (strain NCIMB 400) GN=pckA PE=3 SV=1 69 580 2.0E-135
sp|B2RHV8|PCKA_PORG3 Phosphoenolpyruvate carboxykinase [ATP] OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=pckA PE=3 SV=1 66 580 3.0E-135
sp|O09460|PCKA_ANASU Phosphoenolpyruvate carboxykinase [ATP] OS=Anaerobiospirillum succiniciproducens GN=pckA PE=1 SV=1 66 580 4.0E-135
sp|Q2SPF9|PCKA_HAHCH Phosphoenolpyruvate carboxykinase [ATP] OS=Hahella chejuensis (strain KCTC 2396) GN=pckA PE=3 SV=1 66 580 1.0E-134
sp|B0TMY0|PCKA_SHEHH Phosphoenolpyruvate carboxykinase [ATP] OS=Shewanella halifaxensis (strain HAW-EB4) GN=pckA PE=3 SV=1 69 578 1.0E-133
sp|A6LFQ4|PCKA_PARD8 Phosphoenolpyruvate carboxykinase [ATP] OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=pckA PE=3 SV=1 66 580 7.0E-133
sp|Q83A19|PCKA_COXBU Phosphoenolpyruvate carboxykinase [ATP] OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pckA PE=3 SV=1 88 579 5.0E-132
sp|A9NBT9|PCKA_COXBR Phosphoenolpyruvate carboxykinase [ATP] OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pckA PE=3 SV=1 88 579 5.0E-132
sp|A9KDE5|PCKA_COXBN Phosphoenolpyruvate carboxykinase [ATP] OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pckA PE=3 SV=1 88 579 2.0E-131
sp|Q8A414|PCKA_BACTN Phosphoenolpyruvate carboxykinase [ATP] OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pckA PE=3 SV=1 66 580 2.0E-131
sp|B6J6M2|PCKA_COXB1 Phosphoenolpyruvate carboxykinase [ATP] OS=Coxiella burnetii (strain CbuK_Q154) GN=pckA PE=3 SV=1 88 579 4.0E-131
sp|B6J3V5|PCKA_COXB2 Phosphoenolpyruvate carboxykinase [ATP] OS=Coxiella burnetii (strain CbuG_Q212) GN=pckA PE=3 SV=1 88 579 5.0E-131
sp|Q64MV4|PCKA_BACFR Phosphoenolpyruvate carboxykinase [ATP] OS=Bacteroides fragilis (strain YCH46) GN=pckA PE=3 SV=1 66 580 6.0E-131
sp|Q5L7N5|PCKA_BACFN Phosphoenolpyruvate carboxykinase [ATP] OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pckA PE=3 SV=1 66 580 6.0E-131
sp|Q3ILP3|PCKA_PSEHT Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pckA PE=3 SV=1 71 578 2.0E-130
sp|Q1LU72|PCKA_BAUCH Phosphoenolpyruvate carboxykinase [ATP] OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pckA PE=3 SV=1 62 580 2.0E-127
sp|Q8D1X9|PCKA_WIGBR Phosphoenolpyruvate carboxykinase [ATP] OS=Wigglesworthia glossinidia brevipalpis GN=pckA PE=3 SV=1 66 552 3.0E-127
sp|Q500D1|PCKA_PSEU2 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pckA PE=3 SV=1 65 580 3.0E-124
sp|Q48BY7|PCKA_PSE14 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pckA PE=3 SV=1 65 580 1.0E-123
sp|Q88AZ4|PCKA_PSESM Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pckA PE=3 SV=1 65 580 1.0E-121
sp|Q4KK03|PCKA_PSEF5 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pckA PE=3 SV=1 65 580 3.0E-120
sp|A5VX32|PCKA_PSEP1 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pckA PE=3 SV=1 71 580 3.0E-120
sp|B0KI05|PCKA_PSEPG Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas putida (strain GB-1) GN=pckA PE=3 SV=1 71 580 5.0E-120
sp|A4XP75|PCKA_PSEMY Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas mendocina (strain ymp) GN=pckA PE=3 SV=1 65 580 2.0E-119
sp|A6VDW7|PCKA_PSEA7 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas aeruginosa (strain PA7) GN=pckA PE=3 SV=1 65 580 2.0E-119
sp|B1JET1|PCKA_PSEPW Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas putida (strain W619) GN=pckA PE=3 SV=1 71 580 9.0E-119
sp|B7V3T9|PCKA_PSEA8 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas aeruginosa (strain LESB58) GN=pckA PE=3 SV=1 65 580 2.0E-118
sp|Q02EH2|PCKA_PSEAB Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pckA PE=3 SV=1 65 580 3.0E-118
sp|Q9HTZ7|PCKA_PSEAE Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pckA PE=3 SV=1 65 580 6.0E-118
sp|C3K4J5|PCKA_PSEFS Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas fluorescens (strain SBW25) GN=pckA PE=3 SV=1 65 580 9.0E-116
sp|Q3KJP4|PCKA_PSEPF Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas fluorescens (strain Pf0-1) GN=pckA PE=3 SV=1 65 580 1.0E-115
sp|Q1IGK1|PCKA_PSEE4 Phosphoenolpyruvate carboxykinase [ATP] OS=Pseudomonas entomophila (strain L48) GN=pckA PE=3 SV=1 71 580 3.0E-115
sp|Q9YG68|PCKA_AERPE Phosphoenolpyruvate carboxykinase [ATP] OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pckA PE=3 SV=2 234 477 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004612 phosphoenolpyruvate carboxykinase (ATP) activity Yes
GO:0006094 gluconeogenesis Yes
GO:0044281 small molecule metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0006006 glucose metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0009058 biosynthetic process No
GO:0004611 phosphoenolpyruvate carboxykinase activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0044283 small molecule biosynthetic process No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0046364 monosaccharide biosynthetic process No
GO:0016830 carbon-carbon lyase activity No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016051 carbohydrate biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005996 monosaccharide metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019319 hexose biosynthetic process No
GO:0016829 lyase activity No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0019318 hexose metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0016831 carboxy-lyase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup733
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1323 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7032
Ophiocordyceps camponoti-floridani Ophcf2|01145
Ophiocordyceps camponoti-rufipedis Ophun1|86
Ophiocordyceps kimflemingae Ophio5|6435
Ophiocordyceps subramaniannii Hirsu2|1838

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1323
MTGPSSWVREKQAKSPRRLLSTMISSNVSVNKTALHPGGVQPHRDHTDLEEELHESAHIDYDHVAIIPNPSVAAL
YEDALVYETGTAITSSGALTAYSGKKTGRSPLDKRIVREPSSQDNVWWGPVNKPMSPEVWKINRERAVDYLNTRT
RIYVVDGYAGWDEKYRIRVRVICARAYHALFMRNMLIRPPRKELEHFHPDYTIYNAGSFPANRYTEGMTSPTSVA
INFDQKEMVILGTEYAGEMKKGVFTVLFYEMPIKHNVLTLHSSANEGKNGDVTLFFGLSGTGKTTLSADPNRALI
GDDEHCWSDRGVFNIEGGCYAKCIGLSAEKEPDIFSAIRYGSVLENVVFDPESREVDYDDSTLTENTRCAYPIEY
ISNAKIPCLSPNMPSNIILLTCDARGVLPPISKLDRAQTMFHFISGYTSKMAGTEDGVTEPQATFSSCFAQPFLA
LHPMRYAKMLADKIDQHKANAWLLNTGWVGAGFAHGGKRCPLKYTRAILDAIHSGELANVEYETYDVFNLQVPKS
CPNVPGELLNPQKAWTAGAESFKSEVVKLGKLFRENFTKYESEATEDVVKAGPTV*
Coding >OphauG2|1323
ATGACGGGCCCCTCGTCGTGGGTGCGTGAGAAGCAAGCCAAGTCTCCTCGTCGTCTACTGTCCACCATGATTTCC
TCCAACGTTTCCGTCAACAAGACTGCTCTGCACCCTGGTGGTGTCCAGCCTCATCGTGACCACACCGATCTCGAG
GAGGAGCTTCATGAATCGGCTCACATTGACTACGATCACGTTGCCATTATTCCCAACCCGTCTGTCGCGGCGCTC
TACGAAGATGCCCTTGTCTACGAGACGGGCACAGCCATTACGTCGAGCGGGGCCTTGACGGCATACTCGGGCAAG
AAGACGGGAAGGTCGCCGCTGGATAAGCGCATCGTCCGGGAGCCCTCGTCACAAGACAATGTGTGGTGGGGGCCC
GTCAACAAGCCCATGAGTCCCGAGGTGTGGAAGATCAACCGTGAGCGCGCCGTCGACTATCTCAACACGCGCACC
CGCATCTACGTGGTGGACGGCTACGCAGGATGGGACGAGAAGTACCGCATCCGCGTGCGCGTCATCTGCGCCCGC
GCCTACCACGCCCTCTTTATGCGCAACATGCTCATCCGCCCGCCTCGCAAGGAGCTGGAGCACTTCCACCCCGAC
TACACCATCTACAATGCCGGCAGCTTTCCCGCCAACCGCTACACCGAGGGCATGACATCGCCGACATCAGTGGCC
ATCAACTTTGACCAAAAGGAAATGGTGATTCTCGGCACCGAGTATGCCGGCGAGATGAAGAAGGGAGTCTTCACC
GTGCTCTTTTACGAGATGCCCATCAAGCATAATGTCTTGACGCTGCATTCCTCCGCCAACGAAGGCAAGAATGGT
GATGTGACGCTCTTTTTTGGTCTTTCGGGCACGGGCAAGACGACCTTGTCGGCCGACCCCAACCGCGCCCTGATT
GGTGACGACGAGCATTGCTGGAGTGACCGCGGCGTCTTCAATATCGAGGGCGGCTGCTACGCCAAGTGCATTGGC
TTGTCGGCCGAGAAGGAGCCCGACATTTTCAGTGCCATTCGATACGGCTCTGTGCTCGAGAATGTCGTGTTTGAC
CCCGAGTCTCGCGAAGTGGACTATGATGACTCTACCCTGACTGAAAACACTCGATGTGCGTACCCCATTGAGTAC
ATCAGCAACGCCAAGATACCCTGTCTGTCGCCCAACATGCCCTCCAACATTATTCTCCTGACTTGCGATGCGCGT
GGCGTCTTGCCTCCCATTTCCAAACTCGACCGCGCCCAGACCATGTTCCACTTCATCTCGGGCTACACCTCCAAG
ATGGCTGGTACCGAGGATGGCGTGACGGAGCCTCAGGCTACCTTTTCGTCATGCTTTGCCCAGCCCTTCTTGGCG
CTGCATCCCATGAGGTATGCCAAGATGCTAGCCGACAAGATTGATCAGCACAAGGCCAATGCTTGGCTGCTCAAT
ACCGGATGGGTTGGTGCCGGCTTTGCACATGGCGGCAAGCGCTGTCCTCTCAAGTACACGCGTGCCATCCTGGAT
GCCATTCACTCGGGAGAGCTGGCCAATGTTGAGTATGAGACGTACGACGTGTTCAACCTGCAGGTGCCCAAGTCT
TGCCCCAATGTGCCTGGCGAGCTGCTCAATCCCCAGAAGGCGTGGACTGCGGGAGCAGAGAGCTTCAAGAGCGAA
GTGGTGAAGCTTGGCAAGCTGTTCCGCGAGAATTTCACAAAGTATGAGAGTGAAGCGACCGAGGACGTGGTCAAG
GCGGGACCAACGGTTTAA
Transcript >OphauG2|1323
ATGACGGGCCCCTCGTCGTGGGTGCGTGAGAAGCAAGCCAAGTCTCCTCGTCGTCTACTGTCCACCATGATTTCC
TCCAACGTTTCCGTCAACAAGACTGCTCTGCACCCTGGTGGTGTCCAGCCTCATCGTGACCACACCGATCTCGAG
GAGGAGCTTCATGAATCGGCTCACATTGACTACGATCACGTTGCCATTATTCCCAACCCGTCTGTCGCGGCGCTC
TACGAAGATGCCCTTGTCTACGAGACGGGCACAGCCATTACGTCGAGCGGGGCCTTGACGGCATACTCGGGCAAG
AAGACGGGAAGGTCGCCGCTGGATAAGCGCATCGTCCGGGAGCCCTCGTCACAAGACAATGTGTGGTGGGGGCCC
GTCAACAAGCCCATGAGTCCCGAGGTGTGGAAGATCAACCGTGAGCGCGCCGTCGACTATCTCAACACGCGCACC
CGCATCTACGTGGTGGACGGCTACGCAGGATGGGACGAGAAGTACCGCATCCGCGTGCGCGTCATCTGCGCCCGC
GCCTACCACGCCCTCTTTATGCGCAACATGCTCATCCGCCCGCCTCGCAAGGAGCTGGAGCACTTCCACCCCGAC
TACACCATCTACAATGCCGGCAGCTTTCCCGCCAACCGCTACACCGAGGGCATGACATCGCCGACATCAGTGGCC
ATCAACTTTGACCAAAAGGAAATGGTGATTCTCGGCACCGAGTATGCCGGCGAGATGAAGAAGGGAGTCTTCACC
GTGCTCTTTTACGAGATGCCCATCAAGCATAATGTCTTGACGCTGCATTCCTCCGCCAACGAAGGCAAGAATGGT
GATGTGACGCTCTTTTTTGGTCTTTCGGGCACGGGCAAGACGACCTTGTCGGCCGACCCCAACCGCGCCCTGATT
GGTGACGACGAGCATTGCTGGAGTGACCGCGGCGTCTTCAATATCGAGGGCGGCTGCTACGCCAAGTGCATTGGC
TTGTCGGCCGAGAAGGAGCCCGACATTTTCAGTGCCATTCGATACGGCTCTGTGCTCGAGAATGTCGTGTTTGAC
CCCGAGTCTCGCGAAGTGGACTATGATGACTCTACCCTGACTGAAAACACTCGATGTGCGTACCCCATTGAGTAC
ATCAGCAACGCCAAGATACCCTGTCTGTCGCCCAACATGCCCTCCAACATTATTCTCCTGACTTGCGATGCGCGT
GGCGTCTTGCCTCCCATTTCCAAACTCGACCGCGCCCAGACCATGTTCCACTTCATCTCGGGCTACACCTCCAAG
ATGGCTGGTACCGAGGATGGCGTGACGGAGCCTCAGGCTACCTTTTCGTCATGCTTTGCCCAGCCCTTCTTGGCG
CTGCATCCCATGAGGTATGCCAAGATGCTAGCCGACAAGATTGATCAGCACAAGGCCAATGCTTGGCTGCTCAAT
ACCGGATGGGTTGGTGCCGGCTTTGCACATGGCGGCAAGCGCTGTCCTCTCAAGTACACGCGTGCCATCCTGGAT
GCCATTCACTCGGGAGAGCTGGCCAATGTTGAGTATGAGACGTACGACGTGTTCAACCTGCAGGTGCCCAAGTCT
TGCCCCAATGTGCCTGGCGAGCTGCTCAATCCCCAGAAGGCGTGGACTGCGGGAGCAGAGAGCTTCAAGAGCGAA
GTGGTGAAGCTTGGCAAGCTGTTCCGCGAGAATTTCACAAAGTATGAGAGTGAAGCGACCGAGGACGTGGTCAAG
GCGGGACCAACGGTTTAA
Gene >OphauG2|1323
ATGACGGGCCCCTCGTCGTGGGTGCGTGAGAAGCAAGCCAAGTCTCCTCGTCGTCTACTGTCCACCAGTGAGTCT
CTTGGGCCTCTGTCTCTCATCCATCTCTAACACCGCCTCTAGTGATTTCCTCCAACGTTTCCGTCAACAAGACTG
CTCTGCACCCTGGTGGTGTCCAGTGCGTTGTCCTGCTCCTGCTCCTGCTCTTGCTCTCCGCCCGACTGACGATTG
CTTCTTTTTTTTTTCACAGGCCTCATCGTGACCACACCGATCTCGGTATGCTTTTGCTTGCCGCGTTTGCTTGCC
GCCCTTGCTTGCCGCTCTTGGCATTGTGCCCCAGGCTGACTAGCGGGCCCTGACAGAGGAGGAGCTTCATGAATC
GGCTCACATTGACTACGATCACGTTGCCATTGTATGTCGGCCCAGTCCGACGGCACGAGGCTTCATCTGACTGGA
ACCCATGATAGATTCCCAACCCGTCTGTCGCGGCGCTCTACGAAGATGCCCTTGTCTACGAGACGGGCACAGCCA
TTACGTCGAGCGGGGCCTTGACGGCATACTCGGGCAAGAAGACGGGAAGGTCGCCGCTGGATAAGCGCATCGTCC
GGGAGCCCTCGTCACAAGACAATGTGTGGTAAGTCTGGGCACCGTTGCACGCAACCGTAATTCTGGTAGCTGACG
CTGAAGGTATAGGTGGGGGCCCGTCAACAAGCCCATGAGTCCCGAGGCAAGTTTTTTTTCTTCTTGATTTTTCTT
GATTTTTCTTTTTTCTTCTTTTTTCTTCTTTTTTTTCTTTTTTTTTTTTCTTTCCCGTGTCTTCTCTCTTTTTGC
CTCTTCCTCTCGTCTGGAGTCTTGCTTCCTCGTCTTGTTCGCTGCCCCGCCATGACGCCCAACGTTGCTGCCAAG
ACGGAGCTGCCTATTGGGCAATTGCAGTGGAGGGGCGGATGGATCCGCCGGCTTTTCCCAAGGCATCGGACCAAT
CGGGTCGATCCTGGCGGCGCCCCACACGGCGCGCGGCACATGGCTTCCACACAGTGTGACGTGTGACGCGGCTGC
TAACAGCTTGACAGGTGTGGAAGATCAACCGTGAGCGCGCCGTCGACTATCTCAACACGCGCACCCGCATCTACG
TGGTGGACGGCTACGCAGGATGGGACGAGAAGTACCGCATCCGCGTGCGCGTCATCTGCGCCCGCGCCTACCACG
CCCTCTTTATGCGCAACATGCTCATCCGCCCGCCTCGCAAGGAGCTGGAGCACTTCCACCCCGACTACACCATCT
ACAATGCCGGCAGCTTTCCCGCCAACCGCTACACCGAGGGCATGACATCGCCGACATCAGTGGCCATCAACTTTG
ACCAAAAGGAAATGGTGATTCTCGGCACCGAGTATGCCGGCGAGATGAAGAAGGGAGTCTTCACCGTGCTCTTTT
ACGAGATGCCCATCAAGCATAATGTCTTGACGCTGCATTCCTCCGCCAACGAAGGCAAGAATGGTGATGTGACGC
TCTTTTTTGGTCTTTCGGGCACGGGCAAGACGACCTTGTCGGCCGACCCCAACCGCGCCCTGATTGGTGACGACG
AGCATTGCTGGAGTGACCGCGGCGTCTTCAATATCGAGGGCGGCTGCTACGCCAAGTGCATTGGCTTGTCGGCCG
AGAAGGAGCCCGACATTTTCAGTGCCATTCGATACGGCTCTGTGCTCGAGAATGTCGTGTTTGACCCCGAGTCTC
GCGAAGTGGACTATGATGACTCTACCCTGACTGAAAACACTCGATGGTAAGCCTGACTCAAGCAGAGGCGTCTCT
TTTGCATCCGTCTGACTCGACAACAGTGCGTACCCCATTGAGTACATCAGCAACGCCAAGATACCCTGTCTGTCG
CCCAACATGCCCTCCAACATTATTCTCCTGACTTGCGATGCGCGTGGCGTCTTGCCTCCCATTTCCAAACTCGAC
CGCGCCCAGACCATGTTCCACTTCATCTCGGGCTACACCTCCAAGATGGCTGGTACCGAGGATGGCGTGACGGAG
CCTCAGGCTACCTTTTCGTCATGCTTTGCCCAGCCCTTCTTGGCGCTGCATCCCATGAGGTATGCCAAGATGCTA
GCCGACAAGATTGATCAGCACAAGGCCAATGCTTGGCTGCTCAATACCGGATGGGTTGGTGCCGGCTTTGCACAT
GGCGGCAAGCGCTGTCCTCTCAAGTACACGCGTGCCATCCTGGATGCCATTCACTCGGGAGAGCTGGCCAATGTT
GAGTATGAGACGTACGACGTGTTCAACCTGCAGGTGCCCAAGTCTTGCCCCAATGTGCCTGGCGAGCTGCTCAAT
CCCCAGAAGGCGTGGACTGCGGGAGCAGAGAGCTTCAAGAGCGAAGTGGTGAAGCTTGGCAAGCTGTTCCGCGAG
AATTTCACAAAGTATGAGAGTGAAGCGACCGAGGACGTGGTCAAGGCGGGACCAACGGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail