Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1321
Gene name
LocationContig_1391:2517..4117
Strand+
Gene length (bp)1600
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.4E-26 409 507
PF00403 HMA Heavy-metal-associated domain 5.9E-10 132 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 127 507 3.0E-92
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 131 507 4.0E-39
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 131 507 4.0E-39
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 131 507 4.0E-39
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 131 507 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 127 507 3.0E-92
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 131 507 4.0E-39
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 131 507 4.0E-39
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 131 507 4.0E-39
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 131 507 4.0E-39
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 131 507 4.0E-39
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 125 507 5.0E-39
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 131 507 7.0E-39
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 131 507 7.0E-39
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 131 507 7.0E-39
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 131 507 9.0E-39
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 131 507 9.0E-39
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 131 507 9.0E-39
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 131 507 9.0E-39
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 131 507 1.0E-38
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 131 507 2.0E-38
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 131 507 4.0E-37
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 129 507 3.0E-35
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 129 507 3.0E-35
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 131 507 3.0E-34
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 119 507 3.0E-34
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 131 507 3.0E-34
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 113 507 3.0E-33
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 130 507 1.0E-32
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 131 507 5.0E-32
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 130 507 7.0E-32
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 108 507 9.0E-32
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 131 507 3.0E-31
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 131 507 5.0E-30
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 108 507 5.0E-30
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 133 507 5.0E-30
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 131 507 8.0E-30
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 130 507 7.0E-27
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 125 507 3.0E-26
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 126 507 4.0E-26
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 221 507 2.0E-24
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 220 507 2.0E-22
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 312 507 4.0E-21
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 312 507 4.0E-21
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 326 507 2.0E-20
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 310 507 3.0E-19
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 130 507 3.0E-19
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 126 490 4.0E-19
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 126 507 6.0E-19
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 324 507 1.0E-18
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 309 507 1.0E-18
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 324 507 2.0E-18
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 220 490 1.0E-17
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 220 490 1.0E-17
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 288 507 3.0E-17
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 288 507 3.0E-17
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 288 507 3.0E-17
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 288 507 3.0E-17
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 288 507 3.0E-17
sp|O33533|FIXI_RHILV Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 277 513 3.0E-17
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 110 507 1.0E-16
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 213 507 1.0E-16
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 133 507 6.0E-16
sp|Q9SZC9|HMA6_ARATH Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 343 507 1.0E-15
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 312 507 2.0E-15
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 275 513 3.0E-15
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 288 507 4.0E-15
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 213 507 6.0E-15
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 213 507 9.0E-15
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 317 512 1.0E-14
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 213 507 2.0E-14
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 317 512 2.0E-14
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 375 507 2.0E-14
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 375 507 2.0E-14
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 375 507 2.0E-14
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 342 507 2.0E-14
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 380 507 5.0E-14
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 339 507 6.0E-14
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 222 507 1.0E-13
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 339 507 1.0E-13
sp|P0CW77|HMA3A_ARATH Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 222 507 1.0E-13
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 309 493 1.0E-13
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 320 507 2.0E-13
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 338 507 7.0E-13
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 380 507 8.0E-13
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 327 507 3.0E-12
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 327 507 3.0E-12
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 363 507 9.0E-12
sp|Q59207|FIXI_BRADU Nitrogen fixation protein FixI OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixI PE=3 SV=1 297 507 1.0E-11
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 312 504 1.0E-11
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 358 497 1.0E-10
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 380 507 2.0E-10
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 335 507 2.0E-10
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 335 507 6.0E-10
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 341 483 8.0E-10
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 358 497 5.0E-09
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 358 497 5.0E-09
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 358 497 5.0E-09
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 358 497 5.0E-09
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 341 483 8.0E-09
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 405 507 9.0E-09
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 405 507 9.0E-09
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 405 507 9.0E-09
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 377 507 4.0E-08
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 292 507 4.0E-08
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 424 507 5.0E-08
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 377 507 5.0E-08
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 394 482 6.0E-08
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 394 482 6.0E-08
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 394 482 6.0E-08
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 394 482 6.0E-08
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 394 482 6.0E-08
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 394 482 6.0E-08
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 394 482 6.0E-08
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 394 482 6.0E-08
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 394 482 7.0E-08
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 402 507 1.0E-07
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 363 507 2.0E-07
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 379 499 2.0E-07
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 379 472 3.0E-07
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 379 472 3.0E-07
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 379 472 3.0E-07
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 379 472 3.0E-07
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 379 472 5.0E-07
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 379 472 6.0E-07
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 379 472 6.0E-07
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 381 497 7.0E-07
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 379 472 7.0E-07
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 379 472 7.0E-07
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 379 472 8.0E-07
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 379 472 8.0E-07
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 375 471 2.0E-06
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 381 497 3.0E-06
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 327 499 3.0E-06
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 382 472 4.0E-06
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 379 472 5.0E-06
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 316 501 5.0E-06
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 375 471 5.0E-06
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 414 507 5.0E-06
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 129 507 6.0E-06
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 309 507 7.0E-06
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 309 507 7.0E-06
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 309 507 7.0E-06
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 382 472 7.0E-06
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 382 501 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 279 301 22
2 308 330 22
3 345 367 22
4 374 396 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup373
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1321 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4776
Ophiocordyceps camponoti-floridani Ophcf2|02982
Ophiocordyceps camponoti-rufipedis Ophun1|5321
Ophiocordyceps kimflemingae Ophio5|4426
Ophiocordyceps kimflemingae Ophio5|7351
Ophiocordyceps subramaniannii Hirsu2|10343
Ophiocordyceps subramaniannii Hirsu2|11034
Ophiocordyceps subramaniannii Hirsu2|7397

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1321
MDSDDGHGGPACSVHLARAFEQYSAYLESARRICQKMLRRAWPSRQWDQPARGDGNEANGAAGGGSTGRNGHDDN
QHVGIKSHRVEQFKATRSDKTGCCKQGHDEGWTMMDGSTRTDVDVEAAKEAECIMLSVTGITCSGCANKLERTLR
SFDGVSSVRVNFVMSSAEFSLDGTVASLQDIMRGVEKATGFGCTRVTTTEQSIEVLASGESAKALGKLPLPGVTQ
VTVISSKTVRIGYDATVVGARELVERVSSLSSGLAPPRDDAAISRGRKRLVDQLIMTVIAGAFTLPIVVMAWSDN
LVDKYTEAYVCLAFATIVQVVAVRVFYRPAMAALVHSRSLEMDMLIVISITAAYGYSVVAFGFLMAGRSVDMETF
FETSSLLIFLVLLGRLMAAFARMRAVEAVSLRSLQCNKAIVVQEEGEVEIDARLLQYGDVMKIETHSTVPTDGVV
TEGWSEVDESMLTGESMPVTKQRDDRVIAGTVNGTGVLRARLTRLPGDNTVTDIAQLGGLCRW*
Coding >OphauG2|1321
ATGGATTCCGACGACGGCCACGGTGGCCCGGCATGCAGCGTGCATCTTGCCAGGGCGTTTGAGCAGTACAGCGCA
TACCTCGAGTCGGCTCGACGCATCTGCCAAAAGATGCTCAGGCGCGCATGGCCATCGAGACAGTGGGACCAACCG
GCTCGAGGGGACGGCAACGAAGCAAATGGGGCAGCTGGCGGTGGCTCCACGGGTCGAAACGGCCATGATGATAAC
CAGCATGTCGGCATCAAGAGTCACAGAGTCGAGCAGTTCAAGGCGACGAGGAGCGACAAGACTGGGTGCTGCAAA
CAGGGCCATGACGAGGGCTGGACCATGATGGACGGCAGCACGCGCACAGACGTGGATGTGGAAGCGGCCAAGGAA
GCGGAATGCATCATGCTGAGCGTGACAGGCATAACGTGCTCGGGATGCGCCAACAAGCTGGAGCGGACTCTGAGG
TCGTTTGACGGGGTGTCGTCGGTGCGGGTCAACTTTGTGATGAGCTCGGCCGAGTTTAGCCTGGATGGGACGGTG
GCGTCGCTACAGGACATTATGCGGGGGGTGGAAAAGGCAACGGGGTTTGGCTGCACTCGGGTGACGACGACGGAG
CAGAGCATCGAGGTGCTTGCGTCGGGAGAGTCGGCCAAGGCGCTGGGCAAGCTGCCGCTCCCGGGGGTGACGCAG
GTGACGGTGATTAGCAGCAAGACTGTGCGGATTGGCTACGATGCGACGGTGGTGGGCGCCAGGGAGCTGGTGGAG
AGGGTCAGCTCGCTGTCGTCTGGGCTGGCGCCGCCGCGCGATGATGCGGCGATTTCGCGGGGCAGAAAACGACTG
GTTGACCAGCTCATCATGACGGTGATTGCCGGGGCCTTTACGCTGCCGATTGTGGTGATGGCGTGGAGCGACAAT
TTGGTGGACAAGTATACCGAGGCGTATGTGTGTCTGGCGTTTGCGACGATTGTGCAGGTGGTGGCGGTGCGCGTG
TTTTACCGGCCAGCCATGGCGGCCTTGGTGCACAGCCGGTCGCTGGAGATGGACATGCTGATTGTGATTAGCATC
ACGGCGGCCTACGGGTACTCGGTGGTGGCGTTTGGGTTCCTCATGGCGGGGCGGAGCGTGGACATGGAGACGTTT
TTCGAGACGAGCTCGCTGCTGATTTTCCTGGTGCTGCTGGGGCGGCTGATGGCGGCGTTTGCGCGGATGCGAGCG
GTGGAAGCGGTGTCGCTGCGGTCGCTGCAGTGCAACAAGGCGATTGTAGTGCAGGAGGAGGGCGAGGTGGAGATT
GATGCTCGGCTGCTGCAGTATGGCGATGTGATGAAGATTGAGACGCATTCAACGGTGCCGACGGACGGGGTTGTG
ACGGAGGGATGGAGCGAGGTGGACGAGTCGATGCTGACGGGAGAGAGCATGCCGGTGACGAAGCAGAGGGACGAC
AGGGTGATTGCGGGGACGGTCAACGGGACGGGGGTGCTGCGGGCGCGGCTGACGCGACTGCCGGGCGACAACACG
GTGACGGACATTGCGCAGCTGGGTGGTTTGTGCCGGTGGTGA
Transcript >OphauG2|1321
ATGGATTCCGACGACGGCCACGGTGGCCCGGCATGCAGCGTGCATCTTGCCAGGGCGTTTGAGCAGTACAGCGCA
TACCTCGAGTCGGCTCGACGCATCTGCCAAAAGATGCTCAGGCGCGCATGGCCATCGAGACAGTGGGACCAACCG
GCTCGAGGGGACGGCAACGAAGCAAATGGGGCAGCTGGCGGTGGCTCCACGGGTCGAAACGGCCATGATGATAAC
CAGCATGTCGGCATCAAGAGTCACAGAGTCGAGCAGTTCAAGGCGACGAGGAGCGACAAGACTGGGTGCTGCAAA
CAGGGCCATGACGAGGGCTGGACCATGATGGACGGCAGCACGCGCACAGACGTGGATGTGGAAGCGGCCAAGGAA
GCGGAATGCATCATGCTGAGCGTGACAGGCATAACGTGCTCGGGATGCGCCAACAAGCTGGAGCGGACTCTGAGG
TCGTTTGACGGGGTGTCGTCGGTGCGGGTCAACTTTGTGATGAGCTCGGCCGAGTTTAGCCTGGATGGGACGGTG
GCGTCGCTACAGGACATTATGCGGGGGGTGGAAAAGGCAACGGGGTTTGGCTGCACTCGGGTGACGACGACGGAG
CAGAGCATCGAGGTGCTTGCGTCGGGAGAGTCGGCCAAGGCGCTGGGCAAGCTGCCGCTCCCGGGGGTGACGCAG
GTGACGGTGATTAGCAGCAAGACTGTGCGGATTGGCTACGATGCGACGGTGGTGGGCGCCAGGGAGCTGGTGGAG
AGGGTCAGCTCGCTGTCGTCTGGGCTGGCGCCGCCGCGCGATGATGCGGCGATTTCGCGGGGCAGAAAACGACTG
GTTGACCAGCTCATCATGACGGTGATTGCCGGGGCCTTTACGCTGCCGATTGTGGTGATGGCGTGGAGCGACAAT
TTGGTGGACAAGTATACCGAGGCGTATGTGTGTCTGGCGTTTGCGACGATTGTGCAGGTGGTGGCGGTGCGCGTG
TTTTACCGGCCAGCCATGGCGGCCTTGGTGCACAGCCGGTCGCTGGAGATGGACATGCTGATTGTGATTAGCATC
ACGGCGGCCTACGGGTACTCGGTGGTGGCGTTTGGGTTCCTCATGGCGGGGCGGAGCGTGGACATGGAGACGTTT
TTCGAGACGAGCTCGCTGCTGATTTTCCTGGTGCTGCTGGGGCGGCTGATGGCGGCGTTTGCGCGGATGCGAGCG
GTGGAAGCGGTGTCGCTGCGGTCGCTGCAGTGCAACAAGGCGATTGTAGTGCAGGAGGAGGGCGAGGTGGAGATT
GATGCTCGGCTGCTGCAGTATGGCGATGTGATGAAGATTGAGACGCATTCAACGGTGCCGACGGACGGGGTTGTG
ACGGAGGGATGGAGCGAGGTGGACGAGTCGATGCTGACGGGAGAGAGCATGCCGGTGACGAAGCAGAGGGACGAC
AGGGTGATTGCGGGGACGGTCAACGGGACGGGGGTGCTGCGGGCGCGGCTGACGCGACTGCCGGGCGACAACACG
GTGACGGACATTGCGCAGCTGGGTGGTTTGTGCCGGTGGTGA
Gene >OphauG2|1321
ATGGATTCCGACGACGGCCACGGTGGCCCGGCATGCAGCGTGCATCTTGCCAGGGCGTTTGAGCAGTACAGCGCA
TACCTCGAGTCGGCTCGACGCATCTGCCAAAAGATGCTCAGGCGCGCATGGCCATCGAGACAGTGGGACCAACCG
GCTCGAGGGGACGGCAACGAAGCAAATGGGGCAGCTGGCGGTGGCTCCACGGGTCGAAACGGCCATGATGATAAC
CAGCATGTCGGCATCAAGAGTCACAGAGTCGAGCAGTTCAAGGCGACGAGGAGCGACAAGACTGGGTGCTGCAAA
CAGGGCCATGACGAGGGCTGGACCATGATGGACGGCAGCACGCGCACAGACGTGGATGTGGAAGCGGCCAAGGAA
GCGGAATGCATCATGCTGAGCGTGACAGGCATAACGTGCTCGGGATGCGCCAACAAGCTGGAGCGGACTCTGAGG
TCGTTTGACGGGGTGTCGTCGGTGCGGGTCAACTTTGTGATGAGCTCGGCCGAGTTTAGCCTGGATGGGACGGTG
GCGTCGCTACAGGACATTATGCGGGGGGTGGAAAAGGCAACGGGGTTTGGCTGCACTCGGGTGACGACGACGGAG
CAGAGCATCGAGGTGCTTGCGTCGGGAGAGTCGGCCAAGGCGCTGGGCAAGCTGCCGCTCCCGGGGGTGACGCAG
GTGACGGTGATTAGCAGCAAGACTGTGCGGATTGGCTACGATGCGACGGTGGTGGGCGCCAGGGAGCTGGTGGAG
AGGGTCAGCTCGCTGTCGTCTGGGCTGGCGCCGCCGCGCGATGATGCGGCGATTTCGCGGGGCAGAAAACGACTG
GTTGACCAGCTCATCATGACGGTGATTGCCGGGGCCTTTACGCTGCCGATTGTGGTGATGGCGTGGAGCGACAAT
TTGGTGGACAAGTATACCGAGGCGTATGTGTGTCTGGCGTTTGCGACGATTGTGCAGGTGGTGGCGGTGCGCGTG
TTTTACCGGCCAGCCATGGCGGCCTTGGTGCACAGCCGGTCGCTGGAGATGGACATGCTGATTGTGATTAGCATC
ACGGCGGCCTACGGGTACTCGGTGGTGGCGTTTGGGTTCCTCATGGCGGGGCGGAGCGTGGACATGGAGACGTTT
TTCGAGACGAGCTCGCTGCTGATTTTCCTGGTGCTGCTGGGGCGGCTGATGGCGGCGTTTGCGCGGATGCGAGCG
GTGGAAGCGGTGTCGCTGCGGTCGCTGCAGTGCAACAAGGCGATTGTAGTGCAGGAGGAGGGCGAGGTGGAGATT
GATGCTCGGCTGCTGCAGTATGGCGATGTGATGAAGATTGAGACGCATTCAACGGTGCCGACGGACGGGGTTGTG
ACGGAGGGATGGAGCGAGGTGGACGAGTCGATGCTGACGGGAGAGAGCATGCCGGTGACGAAGCAGAGGGACGAC
AGGGTGATTGCGGGGACGGTCAACGGGACGGGGGTGCTGCGGGCGCGGCTGACGCGACTGCCGGGCGACAACACG
GTGACGGACATTGCGCAGCTGGTGGAGGAAGCGGGCAAGTCGAAGCCGCGGCTGCAGGACATTGCGGACCGCATC
GCAGGGTGGTTTGTGCCGGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail