Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1312
Gene name
LocationContig_139:7152..9128
Strand-
Gene length (bp)1976
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03441 FAD_binding_7 FAD binding domain of DNA photolyase 5.5E-77 317 545
PF00875 DNA_photolyase DNA photolyase 4.1E-38 6 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8QG60|CRY2_CHICK Cryptochrome-2 OS=Gallus gallus GN=CRY2 PE=2 SV=2 5 548 3.0E-122
sp|Q6ZZY0|CRY1_SYLBO Cryptochrome-1 OS=Sylvia borin GN=CRY1 PE=2 SV=1 3 548 6.0E-122
sp|Q8QG61|CRY1_CHICK Cryptochrome-1 OS=Gallus gallus GN=CRY1 PE=2 SV=1 3 548 1.0E-121
sp|P97784|CRY1_MOUSE Cryptochrome-1 OS=Mus musculus GN=Cry1 PE=1 SV=1 3 548 2.0E-121
sp|Q32Q86|CRY1_RAT Cryptochrome-1 OS=Rattus norvegicus GN=Cry1 PE=1 SV=1 3 548 3.0E-121
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8QG60|CRY2_CHICK Cryptochrome-2 OS=Gallus gallus GN=CRY2 PE=2 SV=2 5 548 3.0E-122
sp|Q6ZZY0|CRY1_SYLBO Cryptochrome-1 OS=Sylvia borin GN=CRY1 PE=2 SV=1 3 548 6.0E-122
sp|Q8QG61|CRY1_CHICK Cryptochrome-1 OS=Gallus gallus GN=CRY1 PE=2 SV=1 3 548 1.0E-121
sp|P97784|CRY1_MOUSE Cryptochrome-1 OS=Mus musculus GN=Cry1 PE=1 SV=1 3 548 2.0E-121
sp|Q32Q86|CRY1_RAT Cryptochrome-1 OS=Rattus norvegicus GN=Cry1 PE=1 SV=1 3 548 3.0E-121
sp|Q5IZC5|CRY1_ERIRU Cryptochrome-1 OS=Erithacus rubecula GN=CRY1 PE=2 SV=2 3 548 5.0E-121
sp|Q16526|CRY1_HUMAN Cryptochrome-1 OS=Homo sapiens GN=CRY1 PE=1 SV=1 3 548 1.0E-120
sp|Q8WP19|CRY1_MACFA Cryptochrome-1 OS=Macaca fascicularis GN=CRY1 PE=2 SV=1 3 548 2.0E-120
sp|Q9R194|CRY2_MOUSE Cryptochrome-2 OS=Mus musculus GN=Cry2 PE=1 SV=1 3 548 1.0E-119
sp|Q923I8|CRY2_RAT Cryptochrome-2 OS=Rattus norvegicus GN=Cry2 PE=1 SV=1 3 548 2.0E-119
sp|Q49AN0|CRY2_HUMAN Cryptochrome-2 OS=Homo sapiens GN=CRY2 PE=1 SV=2 7 548 2.0E-118
sp|Q70AD6|CRY1_SPAJD Cryptochrome-1 OS=Spalax judaei GN=CRY1 PE=2 SV=1 3 548 9.0E-118
sp|O48652|UVR3_ARATH (6-4)DNA photolyase OS=Arabidopsis thaliana GN=UVR3 PE=1 SV=2 2 579 1.0E-115
sp|Q0E2Y1|UVR3_ORYSJ (6-4)DNA photolyase OS=Oryza sativa subsp. japonica GN=UVR3 PE=3 SV=1 7 556 3.0E-108
sp|Q17DK5|CRY1_AEDAE Cryptochrome-1 OS=Aedes aegypti GN=cry PE=3 SV=1 7 533 4.0E-75
sp|Q7PYI7|CRY1_ANOGA Cryptochrome-1 OS=Anopheles gambiae GN=Cry1 PE=2 SV=4 7 533 1.0E-69
sp|Q293P8|CRY1_DROPS Cryptochrome-1 OS=Drosophila pseudoobscura pseudoobscura GN=cry PE=3 SV=2 7 577 2.0E-67
sp|O77059|CRY1_DROME Cryptochrome-1 OS=Drosophila melanogaster GN=cry PE=1 SV=1 7 546 3.0E-64
sp|B0WRR9|CRY1_CULQU Cryptochrome-1 OS=Culex quinquefasciatus GN=cry PE=3 SV=1 239 539 3.0E-42
sp|Q4KML2|CRYD_DANRE Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 SV=2 2 531 2.0E-39
sp|P05327|PHR_SYNP6 Deoxyribodipyrimidine photo-lyase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=phr PE=1 SV=4 1 538 5.0E-39
sp|A9CJC9|PHRA_AGRFC Deoxyribodipyrimidine photo-lyase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=phrA PE=1 SV=1 6 543 4.0E-38
sp|Q75WS4|CRYD_XENLA Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE=2 SV=1 6 530 4.0E-37
sp|Q7NMD1|CRYD_GLOVI Cryptochrome DASH OS=Gloeobacter violaceus (strain PCC 7421) GN=cry PE=3 SV=1 1 535 2.0E-36
sp|P77967|CRYD_SYNY3 Cryptochrome DASH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cry PE=1 SV=2 4 539 1.0E-35
sp|Q04449|PHR_BACPE Deoxyribodipyrimidine photo-lyase OS=Bacillus pseudofirmus (strain OF4) GN=phr PE=3 SV=2 240 545 3.0E-34
sp|P12768|PHR_STRGR Deoxyribodipyrimidine photo-lyase OS=Streptomyces griseus GN=phr PE=3 SV=1 7 537 7.0E-34
sp|Q7UJB1|CRYD_RHOBA Cryptochrome DASH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cry PE=3 SV=2 7 533 1.0E-32
sp|Q3IPX9|CRYD_NATPD Cryptochrome DASH OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=cry PE=3 SV=1 7 540 2.0E-32
sp|Q96524|CRY2_ARATH Cryptochrome-2 OS=Arabidopsis thaliana GN=CRY2 PE=1 SV=2 5 544 2.0E-32
sp|Q38JU2|CRYD_SOLLC Cryptochrome DASH, chloroplastic/mitochondrial OS=Solanum lycopersicum GN=CRYD PE=2 SV=2 7 516 5.0E-32
sp|Q9HQ46|PHR_HALSA Deoxyribodipyrimidine photo-lyase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phr PE=3 SV=2 224 549 2.0E-31
sp|P40115|CRY1_SINAL Cryptochrome-1 OS=Sinapis alba GN=PHR1 PE=2 SV=1 5 556 3.0E-31
sp|Q9KNA8|PHR_VIBCH Deoxyribodipyrimidine photo-lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=phrA PE=1 SV=1 276 549 5.0E-31
sp|P00914|PHR_ECOLI Deoxyribodipyrimidine photo-lyase OS=Escherichia coli (strain K12) GN=phrB PE=1 SV=1 7 547 8.0E-31
sp|Q55081|PHR_SYNY3 Deoxyribodipyrimidine photo-lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=phrA PE=1 SV=1 4 538 2.0E-30
sp|Q651U1|CRYD_ORYSJ Cryptochrome DASH, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=CRYD PE=2 SV=1 2 490 9.0E-30
sp|Q5IFN2|CRYD_OSTTA Cryptochrome DASH, chloroplastic/mitochondrial OS=Ostreococcus tauri GN=Ot01g06470 PE=3 SV=1 1 502 1.0E-28
sp|Q84KJ5|CRYD_ARATH Cryptochrome DASH, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=CRYD PE=1 SV=2 6 490 3.0E-28
sp|P57386|PHR_BUCAI Deoxyribodipyrimidine photo-lyase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=phrB PE=3 SV=1 7 547 3.0E-26
sp|P25078|PHR_SALTY Deoxyribodipyrimidine photo-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phrB PE=1 SV=2 377 547 2.0E-25
sp|Q89AJ9|PHR_BUCBP Deoxyribodipyrimidine photo-lyase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=phrB PE=3 SV=1 9 547 8.0E-24
sp|P27526|PHR_NEUCR Deoxyribodipyrimidine photo-lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=phr PE=3 SV=2 6 490 1.0E-23
sp|Q43125|CRY1_ARATH Cryptochrome-1 OS=Arabidopsis thaliana GN=CRY1 PE=1 SV=2 7 559 2.0E-22
sp|Q7SI68|CRYD_NEUCR Putative cryptochrome DASH, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cry PE=3 SV=1 233 509 2.0E-18
sp|Q4I1Q6|CRYD_GIBZE Putative cryptochrome DASH OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_08852 PE=3 SV=1 236 533 8.0E-18
sp|P61496|PHR_THET2 Deoxyribodipyrimidine photo-lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=phr PE=1 SV=1 279 486 4.0E-15
sp|P61497|PHR_THET8 Deoxyribodipyrimidine photo-lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=phr PE=1 SV=1 270 486 1.0E-14
sp|Q9KR33|CRYD_VIBCH Cryptochrome DASH OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cry1 PE=1 SV=1 7 484 3.0E-14
sp|Q5QXE0|CRYD_IDILO Cryptochrome DASH OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cry PE=3 SV=1 1 487 4.0E-14
sp|Q9KS67|CRY2_VIBCH Cryptochrome-like protein cry2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cry2 PE=1 SV=1 261 499 5.0E-14
sp|P05066|PHR_YEAST Deoxyribodipyrimidine photo-lyase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHR1 PE=1 SV=1 378 512 1.0E-13
sp|Q87JP5|CRYD_VIBPA Cryptochrome DASH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cry PE=3 SV=1 378 483 4.0E-10
sp|Q05380|YAT1_SYNP1 Uncharacterized 31.6 kDa protein in atpI 5'region OS=Synechococcus sp. (strain PCC 6716) PE=4 SV=1 1 128 6.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3746
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1312 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5172
Ophiocordyceps camponoti-floridani Ophcf2|06521
Ophiocordyceps camponoti-rufipedis Ophun1|6518
Ophiocordyceps kimflemingae Ophio5|4382
Ophiocordyceps subramaniannii Hirsu2|7302

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1312
MAGPRVIYWFRTDLRLHDSPALKAALDLQPAVLWPIFTWDPHYVYRRKIGLNRWQFLLDCQNDLSESITKLNPNS
KLFVLREAPQTLLPKLFKAWKVTHLVFEKDTDSYGRERDAAVTRAAQEAGVEVLVRPGRTLWDSDDIVASHGGKP
TMSMAQLRAAAAHLGDVPQPLAAPGSLPDPGDMPLDFEPQRPDANPDANAQQRTRQEKAYSSIAGPNNDFAVETM
AELGFPPATTPHRGGETRALKQLEHIVQDTTYTATFEKPKTSPAQLEPPATTLLSPFLHFGALSVRHFYWRVQRV
VDAYGKGASMPPASLTGQLLFRDMYFAVQAAIGAPFEQTATNAHCRFIPWHLPSKRDAQTGRVTGDYHVDSPEAE
AWFLRWKKGVTGFPWIDALMRQLRQEGWIHHLGRHSVACFLTRGGCYVDWERGADVFEELLVDHEPACNAGNWQW
LSCSAFFSQYFRCYSPVSFGQKWDKQGHFIRRWVPELRDLDARYIYEPWKAPIADQKKAHVRVTGDGLDEAGKGT
YPKPMFDFDQRRKTCIAAIKTAYGVGLYGDDARVLHGTWRELFPPPHESEVRGEYESDDGQGADEQDQEAATATG
DKRQADSEAAPSEARPKKHRKKPS*
Coding >OphauG2|1312
ATGGCCGGCCCTCGCGTGATTTACTGGTTTCGGACCGACTTACGGCTTCACGACTCACCTGCTCTCAAGGCGGCT
CTCGATCTGCAGCCGGCCGTGCTGTGGCCCATCTTTACCTGGGATCCCCATTATGTATACCGTCGCAAGATTGGC
CTCAACCGATGGCAATTCCTCCTTGACTGCCAAAACGACCTGTCCGAGTCCATCACCAAGCTCAACCCCAATTCC
AAGCTGTTTGTGCTTCGCGAAGCTCCCCAGACGCTGCTGCCCAAGCTTTTCAAGGCCTGGAAGGTGACCCACCTC
GTCTTTGAAAAGGACACCGACTCGTATGGCCGGGAGCGCGACGCCGCCGTGACCAGGGCTGCCCAAGAGGCCGGA
GTCGAGGTCCTTGTCCGTCCTGGTCGCACACTGTGGGACAGCGACGACATTGTGGCCAGCCATGGCGGCAAGCCG
ACAATGTCCATGGCGCAGCTGCGGGCAGCCGCCGCGCACCTAGGAGACGTGCCTCAGCCCTTGGCCGCGCCTGGC
AGCCTTCCAGACCCGGGCGACATGCCCCTCGACTTTGAGCCCCAGCGCCCAGATGCCAACCCGGACGCAAACGCC
CAGCAACGCACCAGGCAGGAAAAGGCCTACTCCAGCATCGCAGGACCAAACAATGACTTTGCCGTTGAAACCATG
GCCGAGCTGGGCTTCCCGCCCGCAACCACGCCCCATCGTGGCGGCGAGACCAGGGCGCTCAAGCAGCTGGAGCAC
ATTGTCCAGGACACGACCTATACAGCCACCTTTGAGAAGCCCAAGACCAGCCCGGCCCAGTTGGAACCCCCAGCA
ACAACACTGCTGTCGCCCTTTTTACATTTTGGAGCGCTCTCTGTCCGTCACTTCTACTGGCGTGTCCAGCGCGTC
GTCGATGCCTATGGCAAGGGAGCCTCAATGCCTCCTGCCAGTCTAACGGGCCAGCTTCTCTTCCGCGACATGTAC
TTTGCCGTCCAAGCTGCCATTGGGGCCCCCTTTGAGCAAACAGCCACCAATGCCCACTGCCGCTTCATCCCCTGG
CATCTGCCGTCCAAGCGGGATGCCCAGACAGGCCGCGTGACTGGCGACTATCATGTCGACTCGCCAGAGGCCGAG
GCTTGGTTTCTGCGCTGGAAAAAGGGCGTCACGGGGTTTCCCTGGATCGACGCCCTGATGCGACAGCTGCGCCAA
GAGGGCTGGATTCACCACCTGGGCCGTCACTCCGTCGCCTGTTTTCTCACTCGCGGTGGCTGCTATGTCGACTGG
GAACGCGGCGCCGACGTATTTGAAGAGCTGCTGGTGGACCACGAGCCGGCCTGCAACGCTGGCAATTGGCAGTGG
CTCTCGTGCTCTGCCTTTTTCTCCCAGTATTTCCGCTGCTACAGCCCCGTATCGTTTGGCCAGAAATGGGACAAG
CAGGGCCACTTCATCCGCCGCTGGGTACCTGAGCTCAGGGACCTCGACGCACGGTACATCTACGAGCCATGGAAG
GCTCCCATTGCCGACCAGAAAAAGGCACATGTGCGCGTCACGGGCGACGGCCTGGACGAGGCCGGCAAGGGAACC
TATCCCAAGCCCATGTTTGACTTTGACCAACGGCGCAAGACGTGCATTGCAGCAATCAAGACGGCCTATGGCGTT
GGGCTGTACGGCGACGATGCGCGAGTCTTGCATGGCACATGGCGCGAACTCTTTCCCCCGCCCCATGAATCCGAG
GTGCGCGGCGAGTACGAGAGCGATGATGGCCAGGGGGCTGATGAACAAGACCAAGAGGCGGCAACGGCGACGGGT
GACAAGCGGCAGGCTGACTCGGAGGCGGCCCCCTCTGAGGCTCGGCCCAAGAAGCACAGGAAAAAGCCATCATGA
Transcript >OphauG2|1312
ATGGCCGGCCCTCGCGTGATTTACTGGTTTCGGACCGACTTACGGCTTCACGACTCACCTGCTCTCAAGGCGGCT
CTCGATCTGCAGCCGGCCGTGCTGTGGCCCATCTTTACCTGGGATCCCCATTATGTATACCGTCGCAAGATTGGC
CTCAACCGATGGCAATTCCTCCTTGACTGCCAAAACGACCTGTCCGAGTCCATCACCAAGCTCAACCCCAATTCC
AAGCTGTTTGTGCTTCGCGAAGCTCCCCAGACGCTGCTGCCCAAGCTTTTCAAGGCCTGGAAGGTGACCCACCTC
GTCTTTGAAAAGGACACCGACTCGTATGGCCGGGAGCGCGACGCCGCCGTGACCAGGGCTGCCCAAGAGGCCGGA
GTCGAGGTCCTTGTCCGTCCTGGTCGCACACTGTGGGACAGCGACGACATTGTGGCCAGCCATGGCGGCAAGCCG
ACAATGTCCATGGCGCAGCTGCGGGCAGCCGCCGCGCACCTAGGAGACGTGCCTCAGCCCTTGGCCGCGCCTGGC
AGCCTTCCAGACCCGGGCGACATGCCCCTCGACTTTGAGCCCCAGCGCCCAGATGCCAACCCGGACGCAAACGCC
CAGCAACGCACCAGGCAGGAAAAGGCCTACTCCAGCATCGCAGGACCAAACAATGACTTTGCCGTTGAAACCATG
GCCGAGCTGGGCTTCCCGCCCGCAACCACGCCCCATCGTGGCGGCGAGACCAGGGCGCTCAAGCAGCTGGAGCAC
ATTGTCCAGGACACGACCTATACAGCCACCTTTGAGAAGCCCAAGACCAGCCCGGCCCAGTTGGAACCCCCAGCA
ACAACACTGCTGTCGCCCTTTTTACATTTTGGAGCGCTCTCTGTCCGTCACTTCTACTGGCGTGTCCAGCGCGTC
GTCGATGCCTATGGCAAGGGAGCCTCAATGCCTCCTGCCAGTCTAACGGGCCAGCTTCTCTTCCGCGACATGTAC
TTTGCCGTCCAAGCTGCCATTGGGGCCCCCTTTGAGCAAACAGCCACCAATGCCCACTGCCGCTTCATCCCCTGG
CATCTGCCGTCCAAGCGGGATGCCCAGACAGGCCGCGTGACTGGCGACTATCATGTCGACTCGCCAGAGGCCGAG
GCTTGGTTTCTGCGCTGGAAAAAGGGCGTCACGGGGTTTCCCTGGATCGACGCCCTGATGCGACAGCTGCGCCAA
GAGGGCTGGATTCACCACCTGGGCCGTCACTCCGTCGCCTGTTTTCTCACTCGCGGTGGCTGCTATGTCGACTGG
GAACGCGGCGCCGACGTATTTGAAGAGCTGCTGGTGGACCACGAGCCGGCCTGCAACGCTGGCAATTGGCAGTGG
CTCTCGTGCTCTGCCTTTTTCTCCCAGTATTTCCGCTGCTACAGCCCCGTATCGTTTGGCCAGAAATGGGACAAG
CAGGGCCACTTCATCCGCCGCTGGGTACCTGAGCTCAGGGACCTCGACGCACGGTACATCTACGAGCCATGGAAG
GCTCCCATTGCCGACCAGAAAAAGGCACATGTGCGCGTCACGGGCGACGGCCTGGACGAGGCCGGCAAGGGAACC
TATCCCAAGCCCATGTTTGACTTTGACCAACGGCGCAAGACGTGCATTGCAGCAATCAAGACGGCCTATGGCGTT
GGGCTGTACGGCGACGATGCGCGAGTCTTGCATGGCACATGGCGCGAACTCTTTCCCCCGCCCCATGAATCCGAG
GTGCGCGGCGAGTACGAGAGCGATGATGGCCAGGGGGCTGATGAACAAGACCAAGAGGCGGCAACGGCGACGGGT
GACAAGCGGCAGGCTGACTCGGAGGCGGCCCCCTCTGAGGCTCGGCCCAAGAAGCACAGGAAAAAGCCATCATGA
Gene >OphauG2|1312
ATGGCCGGCCCTCGCGTGATTTACTGGTTTCGGACCGACTTACGGCTTCACGACTCACCTGCTCTCAAGGCGGCT
CTCGATCTGCAGCCGGCCGTGCTGTGGCCCATCTTTACCTGGGATCCCCATTATGTATACCGTCGCAAGATTGGC
CTCAACCGATGGCAATTCCTGTATGTCTTGTTTCACCAGCCGCTCAATCGTAGCCTACACAGTACCTTGTACCAT
GTAGACACCTTTGTCCATGACTGACGGGCGACTGACTGGCGACGAGCCTTGACTGCCAAAACGACCTGTCCGAGT
CCATCACCAAGCTCAACCCCAATTCCAAGCTGTTTGTGCTTCGCGAAGCTCCCCAGACGCTGCTGCCCAAGCTTT
TCAAGGCCTGGAAGGTGACCCACCTCGTCTTTGAAAAGGACACCGACTCGTATGGCCGGGAGCGCGACGCCGCCG
TGACCAGGGCTGCCCAAGAGGCCGGAGTCGAGGTCCTTGTCCGTCCTGGTCGCACACTGTGGGACAGCGACGACA
TTGTGGCCAGCCATGGCGGCAAGCCGACAATGTCCATGGCGCAGCTGCGGGCAGCCGCCGCGCACCTAGGAGACG
TGCCTCAGCCCTTGGCCGCGCCTGGCAGCCTTCCAGACCCGGGCGACATGCCCCTCGACTTTGAGCCCCAGCGCC
CAGATGCCAACCCGGACGCAAACGCCCAGCAACGCACCAGGCAGGAAAAGGCCTACTCCAGCATCGCAGGACCAA
ACAATGACTTTGCCGTTGAAACCATGGCCGAGCTGGGCTTCCCGCCCGCAACCACGCCCCATCGTGGCGGCGAGA
CCAGGGCGCTCAAGCAGCTGGAGCACATTGTCCAGGACACGACCTATACAGCCACCTTTGAGAAGCCCAAGACCA
GCCCGGCCCAGTTGGAACCCCCAGCAACAACACTGCTGTCGCCCTTTTTACATTTTGGAGCGCTCTCTGTCCGTC
ACTTCTACTGGCGTGTCCAGCGCGTCGTCGATGCCTATGGCAAGGGAGCCTCAATGCCTCCTGCCAGTCTAACGG
GCCAGCTTCTCTTCCGCGACATGTACTTTGCCGTCCAAGCTGCCATTGGGGCCCCCTTTGAGCAAACAGCCACCA
ATGCCCACTGCCGCTTCATCCCCTGGCATCTGCCGTCCAAGCGGGATGCCCAGACAGGCCGCGTGACTGGCGACT
ATCATGTCGACTCGCCAGAGGCCGAGGCTTGGTTTCTGCGCTGGAAAAAGGGCGTCACGGGGTTTCCCTGGATCG
ACGCCCTGATGCGACAGCTGCGCCAAGAGGGCTGGATTCACCACCTGGGCCGTCACTCCGTCGCCTGTTTTCTCA
CTCGCGGTGGCTGCTATGTCGACTGGGAACGCGGCGCCGACGTATTTGAAGAGCTGCTGGTGGACCACGAGCCGG
CCTGCAACGCTGGCAATTGGCAGTGGCTCTCGTGCTCTGCCTTTTTCTCCCAGTATTTCCGCTGCTACAGCCCCG
TATCGTTTGGCCAGAAATGGGACAAGCAGGGCCACTTCATCCGCCGCTGGGTACCTGAGCTCAGGGACCTCGACG
CACGGTACATCTACGAGCCATGGAAGGCTCCCATTGCCGACCAGAAAAAGGCACATGTGCGCGTCACGGGCGACG
GCCTGGACGAGGCCGGCAAGGGAACCTATCCCAAGCCCATGTTTGACTTTGACCAACGGCGCAAGACGTGCATTG
CAGCAATCAAGACGGCCTATGGCGTTGGGCTGTACGGCGACGATGCGCGAGTCTTGCATGGCACATGGCGCGAAC
TCTTTCCCCCGCCCCATGAATCCGAGGTGCGCGGCGAGTACGAGAGCGATGATGGCCAGGGGGCTGATGAACAAG
ACCAAGAGGCGGCAACGGCGACGGGTGACAAGCGGCAGGCTGACTCGGAGGCGGCCCCCTCTGAGGCTCGGCCCA
AGAAGCACAGGAAAAAGCCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail