Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1308
Gene name
LocationContig_1387:366..3908
Strand+
Gene length (bp)3542
Transcript length (bp)3297
Coding sequence length (bp)3297
Protein length (aa) 1099

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain 2.4E-10 703 752
PF00179 UQ_con Ubiquitin-conjugating enzyme 9.4E-08 984 1068

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VM35|U2QL1_DROME Ubiquitin-conjugating enzyme E2Q-like protein CG4502 OS=Drosophila melanogaster GN=CG4502 PE=2 SV=1 923 1089 3.0E-20
sp|Q8K2Z8|UB2Q2_MOUSE Ubiquitin-conjugating enzyme E2 Q2 OS=Mus musculus GN=Ube2q2 PE=2 SV=2 913 1088 2.0E-18
sp|Q32L27|UB2Q2_BOVIN Ubiquitin-conjugating enzyme E2 Q2 OS=Bos taurus GN=UBE2Q2 PE=2 SV=1 913 1088 3.0E-17
sp|A0PJN4|U2QL1_MOUSE Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Mus musculus GN=Ube2ql1 PE=2 SV=2 945 1088 3.0E-17
sp|Q7YQJ9|UB2Q2_RABIT Ubiquitin-conjugating enzyme E2 Q2 OS=Oryctolagus cuniculus GN=UBE2Q2 PE=2 SV=1 913 1088 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VM35|U2QL1_DROME Ubiquitin-conjugating enzyme E2Q-like protein CG4502 OS=Drosophila melanogaster GN=CG4502 PE=2 SV=1 923 1089 3.0E-20
sp|Q8K2Z8|UB2Q2_MOUSE Ubiquitin-conjugating enzyme E2 Q2 OS=Mus musculus GN=Ube2q2 PE=2 SV=2 913 1088 2.0E-18
sp|Q32L27|UB2Q2_BOVIN Ubiquitin-conjugating enzyme E2 Q2 OS=Bos taurus GN=UBE2Q2 PE=2 SV=1 913 1088 3.0E-17
sp|A0PJN4|U2QL1_MOUSE Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Mus musculus GN=Ube2ql1 PE=2 SV=2 945 1088 3.0E-17
sp|Q7YQJ9|UB2Q2_RABIT Ubiquitin-conjugating enzyme E2 Q2 OS=Oryctolagus cuniculus GN=UBE2Q2 PE=2 SV=1 913 1088 4.0E-17
sp|Q8WVN8|UB2Q2_HUMAN Ubiquitin-conjugating enzyme E2 Q2 OS=Homo sapiens GN=UBE2Q2 PE=1 SV=1 913 1088 6.0E-17
sp|A1L167|U2QL1_HUMAN Ubiquitin-conjugating enzyme E2Q-like protein 1 OS=Homo sapiens GN=UBE2QL1 PE=1 SV=2 945 1088 6.0E-17
sp|Q93571|UBC25_CAEEL Ubiquitin-conjugating enzyme E2 25 OS=Caenorhabditis elegans GN=ubc-25 PE=2 SV=2 919 1088 1.0E-16
sp|Q7Z7E8|UB2Q1_HUMAN Ubiquitin-conjugating enzyme E2 Q1 OS=Homo sapiens GN=UBE2Q1 PE=1 SV=1 913 1088 1.0E-16
sp|Q7TSS2|UB2Q1_MOUSE Ubiquitin-conjugating enzyme E2 Q1 OS=Mus musculus GN=Ube2q1 PE=1 SV=2 913 1088 2.0E-16
sp|Q5RDU4|PARP6_PONAB Poly [ADP-ribose] polymerase 6 OS=Pongo abelii GN=PARP6 PE=2 SV=1 623 799 5.0E-11
sp|Q6P6P7|PARP6_MOUSE Poly [ADP-ribose] polymerase 6 OS=Mus musculus GN=Parp6 PE=2 SV=1 623 799 6.0E-11
sp|Q2NL67|PARP6_HUMAN Poly [ADP-ribose] polymerase 6 OS=Homo sapiens GN=PARP6 PE=2 SV=1 623 799 6.0E-11
sp|Q3UD82|PARP8_MOUSE Poly [ADP-ribose] polymerase 8 OS=Mus musculus GN=Parp8 PE=2 SV=1 623 822 1.0E-09
sp|Q8N3A8|PARP8_HUMAN Poly [ADP-ribose] polymerase 8 OS=Homo sapiens GN=PARP8 PE=2 SV=1 623 740 3.0E-09
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1 922 1081 6.0E-08
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1 922 1081 6.0E-08
sp|D3ZDK2|UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus GN=Ube2d1 PE=1 SV=1 922 1081 6.0E-08
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1 922 1081 6.0E-08
sp|P70711|U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=1 SV=1 919 1081 3.0E-07
sp|Q6ZWY6|U2D2B_MOUSE Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=1 SV=1 919 1081 3.0E-07
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1 952 1081 8.0E-07
sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1 952 1081 2.0E-06
sp|Q06AA9|UB2D2_PIG Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1 952 1081 2.0E-06
sp|Q4R5N4|UB2D3_MACFA Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1 952 1081 2.0E-06
sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=1 SV=1 952 1081 2.0E-06
sp|Q5R4V7|UB2D3_PONAB Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1 952 1081 2.0E-06
sp|P61078|UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1 952 1081 2.0E-06
sp|P62840|UB2D2_XENLA Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1 952 1081 3.0E-06
sp|P62839|UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=1 SV=1 952 1081 3.0E-06
sp|P62838|UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1 952 1081 3.0E-06
sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1 952 1081 3.0E-06
sp|Q1RMX2|UB2D2_BOVIN Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1 952 1081 3.0E-06
sp|A5PKP9|UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis GN=ube2d4 PE=1 SV=1 922 1081 4.0E-06
sp|P15732|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC5 PE=1 SV=1 952 1072 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016763 pentosyltransferase activity No
GO:0016740 transferase activity No
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1308 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6121
Ophiocordyceps camponoti-floridani Ophcf2|05823
Ophiocordyceps camponoti-rufipedis Ophun1|1675
Ophiocordyceps kimflemingae Ophio5|7603
Ophiocordyceps subramaniannii Hirsu2|6673

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1308
MAFKVFLQDLKEAINTQFDNVIALRRGDVDNGLVFVFSHPNLDKPLEIELVVQDVEKYRRNATFMMFASLDGPAA
TDLCRYLQNLSPRLPGEGTVTDIVTLVSGCLSTKLSGVAGDEEEEQDLTMEQDEPEDGLTDDSSLRSHSTDGWWS
STAQIAAAAGMAVVFFPPDQQKAPEAISLSLPVSVLGLLDDALEAWNLEPHHHLVLFIRIVDTLSSFQDYCDQPS
QQEYLQFYFGKCASAAPSYDGFRHLFSHSPQPTSPQGVPPADKGDRALFDGPLCEPHFMTGSINRLLNHCLHRLL
KLRRNLNLSWTAAQELLCNMDRNTATDTAPLRHVEDGILVCPQAPASLRHDFALDAVEQFSIPIVAMQLALRSLA
RCTEYCMTCYRKVNDGCDSLKPYVCMDPLCLYQYLTLGFGPSIELEILHRPYVVDLLISFFYSATVYGTVKTVPP
GLCLKCIDFTDVSSRVVVMIGADIKMLRLGSQANCNVAQGSWFGLATPQLTDGFTDFGYAICRVANVINESSFYY
EILVNSYHASASITNQLKKHLTSLSCSQKPVNGNWNPAFAFFKNPDLELFSESELKMWAMSQILCCVPSVLEMRT
FLQNYPGTPLSSWSRMNRSTLFLLQWILASNRSHIVQDQPLRSSVRSRDGFLAQEMAIDSRGVPDHLQFRFVQGA
PDKELQFVKQLKTHVLSGNGGNSKYPTLFAWHGSHLSNWHSIIRNGLNFDKRSHGRTFGHGVYMSRSMVCSSSYV
RTGSALSVIRSPQFSDGEFLAMPATCWPNSVLKPSTVLSLCEIVNRPDLFVSQSPHYVVDNVEWIQCRYLYVSIC
PSAESLRDVHPGAEVKQFEGNIPQEPSRELYGYGDKRFEIPWSAIPPLRRQLMEPNGNRQSVSTKSSGFCTGSLD
FDSLPKMPEPSWAASSPQALAALGREIKELHQTQAKTAIRDLGWYIDVARVDNLFHWIVELHSFEESLPLAQDMA
RMGSISVVLEVRFGSNYPFSPPFVRVIRPRFLPFSRGGGGHVTAGGAICSEMLTGTGWSPVLGMEKVLIQVRLGL
CDADPPARLDTAIGQDYSVSEAIDAYIRAARTHGWQVPADVAQISRGW*
Coding >OphauG2|1308
ATGGCCTTCAAGGTCTTCCTCCAGGACCTCAAAGAGGCCATCAACACGCAGTTTGACAATGTCATTGCCCTGCGC
AGAGGCGATGTCGACAATGGCCTCGTCTTTGTCTTCTCGCACCCAAACCTTGACAAGCCACTCGAGATTGAGCTC
GTTGTCCAAGATGTGGAAAAGTACCGCCGAAATGCTACGTTCATGATGTTTGCCTCGCTCGACGGTCCTGCTGCT
ACTGACCTATGTCGCTACCTCCAGAATCTGTCTCCGCGACTTCCCGGGGAGGGCACCGTCACAGACATTGTCACT
CTTGTTTCGGGTTGCCTCTCCACGAAACTGTCGGGTGTTGCTGGCGATGAAGAAGAAGAACAAGACTTAACCATG
GAGCAAGACGAGCCCGAGGATGGACTGACTGACGACTCCAGTCTGCGCTCGCACAGCACAGACGGCTGGTGGTCC
TCGACGGCTCAGATAGCTGCCGCAGCAGGCATGGCCGTCGTCTTTTTCCCCCCTGATCAGCAGAAAGCGCCCGAA
GCTATCTCGCTCTCTCTGCCTGTCTCAGTGCTCGGTCTCCTGGACGATGCTCTGGAAGCCTGGAACCTTGAACCA
CACCACCACTTGGTGCTCTTTATTCGCATCGTCGACACACTTTCGTCTTTCCAGGACTATTGTGACCAGCCCTCT
CAGCAAGAGTATCTCCAGTTTTATTTCGGGAAATGCGCATCTGCCGCGCCTTCTTACGACGGATTTCGCCATTTA
TTTTCCCACAGTCCCCAACCTACAAGCCCGCAAGGAGTTCCGCCGGCAGACAAGGGCGATAGAGCCCTCTTTGAC
GGCCCCCTATGCGAACCACATTTTATGACGGGATCCATCAACCGCTTGCTTAACCACTGTCTTCATCGACTCCTC
AAACTGCGACGAAATTTGAATTTATCCTGGACGGCGGCACAAGAGCTCTTGTGTAACATGGACCGAAATACCGCG
ACTGATACAGCCCCTTTGCGTCATGTTGAAGATGGGATTCTTGTTTGCCCCCAGGCACCTGCCTCTTTGCGTCAC
GACTTTGCTCTGGACGCCGTCGAGCAGTTCAGCATTCCCATTGTCGCCATGCAGCTTGCCTTACGGAGTCTTGCA
CGCTGCACCGAGTACTGTATGACGTGCTACCGCAAAGTCAATGACGGGTGCGACTCGCTGAAGCCATATGTCTGC
ATGGATCCTCTGTGCCTCTACCAGTATCTCACGCTGGGGTTTGGCCCAAGCATCGAGCTAGAAATCCTTCATCGG
CCCTACGTTGTTGACCTTCTTATCAGCTTCTTCTATTCGGCTACTGTTTATGGCACCGTTAAAACCGTACCGCCG
GGCCTTTGCCTCAAGTGTATTGATTTCACAGATGTCTCTAGTCGCGTGGTAGTCATGATTGGAGCCGACATCAAG
ATGCTACGACTAGGTAGCCAAGCTAATTGCAATGTCGCACAGGGAAGCTGGTTCGGGTTGGCCACTCCGCAGCTA
ACGGACGGATTCACCGATTTTGGATACGCCATATGTCGCGTGGCCAATGTCATCAATGAGTCGTCCTTCTATTAC
GAGATTTTAGTGAATTCCTACCACGCCTCAGCCTCCATCACAAATCAACTCAAAAAGCATCTAACTTCATTATCT
TGCTCACAAAAACCTGTTAATGGAAACTGGAATCCGGCCTTTGCATTCTTCAAGAATCCTGATCTAGAGCTCTTC
TCTGAAAGCGAATTGAAGATGTGGGCAATGTCGCAGATACTGTGCTGCGTACCCTCGGTACTTGAAATGAGAACT
TTCCTACAGAACTACCCCGGTACCCCTCTCTCGAGCTGGAGCCGCATGAACAGATCTACACTTTTTCTATTACAA
TGGATTCTTGCGTCCAATCGGTCGCACATTGTGCAGGATCAACCTCTTCGGTCCAGCGTTAGAAGCCGCGATGGC
TTTTTGGCACAAGAGATGGCAATTGACTCTAGGGGGGTTCCCGATCACCTGCAGTTTCGATTTGTGCAAGGGGCA
CCTGACAAGGAGCTCCAATTTGTGAAGCAGCTCAAGACCCATGTGCTGTCTGGGAATGGCGGCAACTCCAAGTAC
CCTACCCTGTTTGCATGGCACGGTAGTCACTTGTCCAACTGGCATAGCATCATTCGCAATGGTCTGAACTTTGAC
AAAAGAAGTCATGGCCGGACATTTGGGCATGGCGTTTATATGAGTCGATCCATGGTCTGCAGCAGCAGTTATGTC
CGTACAGGGTCAGCACTGTCCGTAATACGAAGTCCGCAATTTTCTGACGGCGAATTTCTCGCCATGCCCGCCACT
TGTTGGCCAAATTCGGTTCTGAAGCCATCGACGGTTCTGAGTCTCTGTGAAATTGTCAACAGGCCAGATTTGTTT
GTCAGTCAGTCTCCACACTACGTCGTGGACAACGTTGAGTGGATCCAATGCCGCTATCTGTATGTTTCGATATGT
CCATCTGCCGAGTCTTTGAGGGACGTACATCCTGGCGCAGAAGTCAAGCAATTCGAGGGCAACATCCCCCAAGAG
CCAAGTCGAGAACTTTATGGATATGGCGACAAGCGTTTTGAAATTCCTTGGTCAGCCATACCGCCCCTCCGACGC
CAGCTAATGGAGCCAAATGGGAATAGGCAGAGTGTTTCAACAAAGTCAAGTGGCTTTTGCACCGGATCGCTAGAC
TTTGACTCGCTTCCCAAGATGCCAGAACCCTCGTGGGCGGCGTCCTCTCCGCAAGCACTTGCTGCTCTTGGTCGT
GAGATCAAGGAGCTACACCAGACACAGGCCAAGACGGCGATAAGGGACTTGGGCTGGTATATTGACGTGGCGCGC
GTCGACAACCTGTTTCATTGGATTGTGGAGCTACACAGCTTTGAAGAGTCGCTTCCTCTGGCGCAAGATATGGCA
CGAATGGGCAGCATCAGCGTAGTGCTTGAGGTGCGCTTTGGCAGCAATTATCCCTTCTCGCCGCCTTTTGTGCGT
GTCATCCGGCCGCGCTTTCTGCCCTTTTCGCGAGGGGGCGGAGGACATGTGACTGCAGGTGGTGCTATTTGCTCC
GAGATGCTCACTGGGACTGGCTGGTCGCCGGTGTTGGGCATGGAAAAGGTATTGATCCAGGTGCGTTTGGGGTTA
TGCGATGCCGATCCGCCCGCCAGGCTCGACACAGCCATTGGCCAAGATTATAGTGTTTCTGAGGCCATCGATGCA
TATATTCGGGCGGCTCGGACGCATGGCTGGCAAGTCCCGGCCGACGTTGCACAAATAAGTCGAGGCTGGTGA
Transcript >OphauG2|1308
ATGGCCTTCAAGGTCTTCCTCCAGGACCTCAAAGAGGCCATCAACACGCAGTTTGACAATGTCATTGCCCTGCGC
AGAGGCGATGTCGACAATGGCCTCGTCTTTGTCTTCTCGCACCCAAACCTTGACAAGCCACTCGAGATTGAGCTC
GTTGTCCAAGATGTGGAAAAGTACCGCCGAAATGCTACGTTCATGATGTTTGCCTCGCTCGACGGTCCTGCTGCT
ACTGACCTATGTCGCTACCTCCAGAATCTGTCTCCGCGACTTCCCGGGGAGGGCACCGTCACAGACATTGTCACT
CTTGTTTCGGGTTGCCTCTCCACGAAACTGTCGGGTGTTGCTGGCGATGAAGAAGAAGAACAAGACTTAACCATG
GAGCAAGACGAGCCCGAGGATGGACTGACTGACGACTCCAGTCTGCGCTCGCACAGCACAGACGGCTGGTGGTCC
TCGACGGCTCAGATAGCTGCCGCAGCAGGCATGGCCGTCGTCTTTTTCCCCCCTGATCAGCAGAAAGCGCCCGAA
GCTATCTCGCTCTCTCTGCCTGTCTCAGTGCTCGGTCTCCTGGACGATGCTCTGGAAGCCTGGAACCTTGAACCA
CACCACCACTTGGTGCTCTTTATTCGCATCGTCGACACACTTTCGTCTTTCCAGGACTATTGTGACCAGCCCTCT
CAGCAAGAGTATCTCCAGTTTTATTTCGGGAAATGCGCATCTGCCGCGCCTTCTTACGACGGATTTCGCCATTTA
TTTTCCCACAGTCCCCAACCTACAAGCCCGCAAGGAGTTCCGCCGGCAGACAAGGGCGATAGAGCCCTCTTTGAC
GGCCCCCTATGCGAACCACATTTTATGACGGGATCCATCAACCGCTTGCTTAACCACTGTCTTCATCGACTCCTC
AAACTGCGACGAAATTTGAATTTATCCTGGACGGCGGCACAAGAGCTCTTGTGTAACATGGACCGAAATACCGCG
ACTGATACAGCCCCTTTGCGTCATGTTGAAGATGGGATTCTTGTTTGCCCCCAGGCACCTGCCTCTTTGCGTCAC
GACTTTGCTCTGGACGCCGTCGAGCAGTTCAGCATTCCCATTGTCGCCATGCAGCTTGCCTTACGGAGTCTTGCA
CGCTGCACCGAGTACTGTATGACGTGCTACCGCAAAGTCAATGACGGGTGCGACTCGCTGAAGCCATATGTCTGC
ATGGATCCTCTGTGCCTCTACCAGTATCTCACGCTGGGGTTTGGCCCAAGCATCGAGCTAGAAATCCTTCATCGG
CCCTACGTTGTTGACCTTCTTATCAGCTTCTTCTATTCGGCTACTGTTTATGGCACCGTTAAAACCGTACCGCCG
GGCCTTTGCCTCAAGTGTATTGATTTCACAGATGTCTCTAGTCGCGTGGTAGTCATGATTGGAGCCGACATCAAG
ATGCTACGACTAGGTAGCCAAGCTAATTGCAATGTCGCACAGGGAAGCTGGTTCGGGTTGGCCACTCCGCAGCTA
ACGGACGGATTCACCGATTTTGGATACGCCATATGTCGCGTGGCCAATGTCATCAATGAGTCGTCCTTCTATTAC
GAGATTTTAGTGAATTCCTACCACGCCTCAGCCTCCATCACAAATCAACTCAAAAAGCATCTAACTTCATTATCT
TGCTCACAAAAACCTGTTAATGGAAACTGGAATCCGGCCTTTGCATTCTTCAAGAATCCTGATCTAGAGCTCTTC
TCTGAAAGCGAATTGAAGATGTGGGCAATGTCGCAGATACTGTGCTGCGTACCCTCGGTACTTGAAATGAGAACT
TTCCTACAGAACTACCCCGGTACCCCTCTCTCGAGCTGGAGCCGCATGAACAGATCTACACTTTTTCTATTACAA
TGGATTCTTGCGTCCAATCGGTCGCACATTGTGCAGGATCAACCTCTTCGGTCCAGCGTTAGAAGCCGCGATGGC
TTTTTGGCACAAGAGATGGCAATTGACTCTAGGGGGGTTCCCGATCACCTGCAGTTTCGATTTGTGCAAGGGGCA
CCTGACAAGGAGCTCCAATTTGTGAAGCAGCTCAAGACCCATGTGCTGTCTGGGAATGGCGGCAACTCCAAGTAC
CCTACCCTGTTTGCATGGCACGGTAGTCACTTGTCCAACTGGCATAGCATCATTCGCAATGGTCTGAACTTTGAC
AAAAGAAGTCATGGCCGGACATTTGGGCATGGCGTTTATATGAGTCGATCCATGGTCTGCAGCAGCAGTTATGTC
CGTACAGGGTCAGCACTGTCCGTAATACGAAGTCCGCAATTTTCTGACGGCGAATTTCTCGCCATGCCCGCCACT
TGTTGGCCAAATTCGGTTCTGAAGCCATCGACGGTTCTGAGTCTCTGTGAAATTGTCAACAGGCCAGATTTGTTT
GTCAGTCAGTCTCCACACTACGTCGTGGACAACGTTGAGTGGATCCAATGCCGCTATCTGTATGTTTCGATATGT
CCATCTGCCGAGTCTTTGAGGGACGTACATCCTGGCGCAGAAGTCAAGCAATTCGAGGGCAACATCCCCCAAGAG
CCAAGTCGAGAACTTTATGGATATGGCGACAAGCGTTTTGAAATTCCTTGGTCAGCCATACCGCCCCTCCGACGC
CAGCTAATGGAGCCAAATGGGAATAGGCAGAGTGTTTCAACAAAGTCAAGTGGCTTTTGCACCGGATCGCTAGAC
TTTGACTCGCTTCCCAAGATGCCAGAACCCTCGTGGGCGGCGTCCTCTCCGCAAGCACTTGCTGCTCTTGGTCGT
GAGATCAAGGAGCTACACCAGACACAGGCCAAGACGGCGATAAGGGACTTGGGCTGGTATATTGACGTGGCGCGC
GTCGACAACCTGTTTCATTGGATTGTGGAGCTACACAGCTTTGAAGAGTCGCTTCCTCTGGCGCAAGATATGGCA
CGAATGGGCAGCATCAGCGTAGTGCTTGAGGTGCGCTTTGGCAGCAATTATCCCTTCTCGCCGCCTTTTGTGCGT
GTCATCCGGCCGCGCTTTCTGCCCTTTTCGCGAGGGGGCGGAGGACATGTGACTGCAGGTGGTGCTATTTGCTCC
GAGATGCTCACTGGGACTGGCTGGTCGCCGGTGTTGGGCATGGAAAAGGTATTGATCCAGGTGCGTTTGGGGTTA
TGCGATGCCGATCCGCCCGCCAGGCTCGACACAGCCATTGGCCAAGATTATAGTGTTTCTGAGGCCATCGATGCA
TATATTCGGGCGGCTCGGACGCATGGCTGGCAAGTCCCGGCCGACGTTGCACAAATAAGTCGAGGCTGGTGA
Gene >OphauG2|1308
ATGGCCTTCAAGGTCTTCCTCCAGGACCTCAAAGAGGCCATCAACACGCAGTTTGACAATGTCATTGCCCTGCGC
AGAGGCGATGTCGACAATGGCCTCGTCTTTGTCTTCTCGCACCCAAACCTTGACAAGCCACTCGAGATTGAGCTC
GTTGTCCAAGGTAAACTCTTGGCCACCACCACCATGGCCTCCCTACGTCCTCTTTGCAGCCCGGAAACTCATGCA
ACATACAGATGTGGAAAAGTACCGCCGAAATGCTACGTTCATGATGTTTGCCTCGCTCGACGGTCCTGCTGCTAC
TGACCTATGTCGCTACCTCCAGAATCTGTCTCCGCGACTTCCCGGGGAGGGCACCGTCACAGACATTGTCACTCT
TGTTTCGGGTTGCCTCTCCACGAAACTGTCGGGTGTTGCTGGCGATGAAGAAGAAGAACAAGACTTAACCATGGA
GCAAGACGAGCCCGAGGATGGACTGACTGACGACTCCAGTCTGCGCTCGCACAGCACAGACGGCTGGTGGTCCTC
GACGGCTCAGATAGCTGCCGCAGCAGGCATGGCCGTCGTCTTTTTCCCCCCTGATCAGCAGAAAGCGCCCGAAGC
TATCTCGCTCTCTCTGCCTGTCTCAGTGCTCGGTCTCCTGGACGATGCTCTGGAAGCCTGGAACCTTGAACCACA
CCACCACTTGGTGCTCTTTATTCGCATCGTCGACACACTTTCGTCTTTCCAGGACTATTGTGACCAGCCCTCTCA
GCAAGAGTATCTCCAGTTTTATTTCGGGAAATGCGCATCTGCCGCGCCTTCTTACGACGGATTTCGCCATTTATT
TTCCCACAGTCCCCAACCTACAAGCCCGCAAGGAGTTCCGCCGGCAGACAAGGGCGATAGAGCCCTCTTTGACGG
CCCCCTATGCGAACCACATTTTATGACGGGATCCATCAACCGCTTGCTTAACCACTGTCTTCATCGACTCCTCAA
ACTGCGACGAAATTTGAATTTATCCTGGACGGCGGCACAAGAGCTCTTGTGTAACATGGACCGAAATACCGCGAC
TGATACAGCCCCTTTGCGTCATGTTGAAGATGGGATTCTTGTTTGCCCCCAGGCACCTGCCTCTTTGCGTCACGA
CTTTGCTCTGGACGCCGTCGAGCAGTTCAGCATTCCCATTGTCGCCATGCAGCTTGCCTTACGGAGTCTTGCACG
CTGCACCGAGTACTGTATGACGTGCTACCGCAAAGTCAATGACGGGTGCGACTCGCTGAAGCCATATGTCTGCAT
GGATCCTCTGTGCCTCTACCAGTATCTCACGCTGGGGTTTGGCCCAAGCATCGAGCTAGAAATCCTTCATCGGCC
CTACGTTGTTGACCTTCTTATCAGCTTCTTCTATTCGGCTACTGTTTATGGCACCGTTAAAACCGTACCGCCGGG
CCTTTGCCTCAAGTGTATTGATTTCACAGATGTCTCTAGTCGCGTGGTAGTCATGATTGGAGCCGACATCAAGAT
GCTACGACTAGGTAGCCAAGCTAATTGCAATGTCGCACAGGGAAGCTGGTTCGGGTTGGCCACTCCGCAGCTAAC
GGACGGATTCACCGGTATGATGCCACACCCCCTTGAGTACGCTGGCCGGCACGCGACGCTACCACTACTTTTCTT
TTCTTTAATTCTACCCAAGTAGCTGACTGGACGCTCGCAAGATTTTGGATACGCCATATGTCGCGTGGCCAATGT
CATCAATGAGTCGTCCTTCTATTACGAGATTTTAGTGAATTCCTACCACGCCTCAGCCTCCATCACAAATCAACT
CAAAAAGCATCTAACTTCATTATCTTGCTCACAAAAACCTGTTAATGGAAACTGGAATCCGGCCTTTGCATTCTT
CAAGAATCCTGATCTAGAGCTCTTCTCTGAAAGCGAATTGAAGATGTGGGCAATGTCGCAGATACTGTGCTGCGT
ACCCTCGGTACTTGAAATGAGAACTTTCCTACAGAACTACCCCGGTACCCCTCTCTCGAGCTGGAGCCGCATGAA
CAGATCTACACTTTTTCTATTACAATGGATTCTTGCGTCCAATCGGTCGCACATTGTGCAGGATCAACCTCTTCG
GTCCAGCGTTAGAAGCCGCGATGGCTTTTTGGCACAAGAGATGGCAATTGACTCTAGGGGGGTTCCCGATCACCT
GCAGTTTCGATTTGTGCAAGGGGCACCTGACAAGGAGCTCCAATTTGTGAAGCAGCTCAAGACCCATGTGCTGTC
TGGGAATGGCGGCAACTCCAAGTACCCTACCCTGTTTGCATGGCACGGTAGTCACTTGTCCAACTGGCATAGCAT
CATTCGCAATGGTCTGAACTTTGACAAAAGAAGTCATGGCCGGACATTTGGGCATGGCGTTTATATGAGTCGATC
CATGGTCTGCAGCAGCAGTTATGTCCGTACAGGGTCAGCACTGTCCGTAATACGAAGTCCGCAATTTTCTGACGG
CGAATTTCTCGCCATGGTAAGCATGCATACATACCAACGGGTTTATTACTTATTCAGATGCTGACAGAATCCTGG
GCCATGTACAGCCCGCCACTTGTTGGCCAAATTCGGTTCTGAAGCCATCGACGGTTCTGAGTCTCTGTGAAATTG
TCAACAGGCCAGATTTGTTTGTCAGTCAGTCTCCACACTACGTCGTGGACAACGTTGAGTGGATCCAATGCCGCT
ATCTGTATGTTTCGATATGTCCATCTGCCGAGTCTTTGAGGGACGTACATCCTGGCGCAGAAGTCAAGCAATTCG
AGGGCAACATCCCCCAAGAGCCAAGTCGAGAACTTTATGGATATGGCGACAAGCGTTTTGAAATTCCTTGGTCAG
CCATACCGCCCCTCCGACGCCAGCTAATGGAGCCAAATGGGAATAGGCAGAGTGTTTCAACAAAGTCAAGTGGCT
TTTGCACCGGATCGCTAGACTTTGACTCGCTTCCCAAGATGCCAGAACCCTCGTGGGCGGCGTCCTCTCCGCAAG
CACTTGCTGCTCTTGGTCGTGAGATCAAGGAGCTACACCAGACACAGGCCAAGACGGCGATAAGGGACTTGGGCT
GGTATATTGACGTGGCGCGCGTCGACAACCTGTTTCATTGGATTGTGGAGCTACACAGCTTTGAAGAGTCGCTTC
CTCTGGCGCAAGATATGGCACGAATGGGCAGCATCAGCGTAGTGCTTGAGGTGCGCTTTGGCAGCAATTATCCCT
TCTCGCCGCCTTTTGTGCGTGTCATCCGGCCGCGCTTTCTGCCCTTTTCGCGAGGGGGCGGAGGACATGTGACTG
CAGGTGGTGCTATTTGCTCCGAGATGCTCACTGGGACTGGCTGGTCGCCGGTGTTGGGCATGGAAAAGGTATTGA
TCCAGGTGCGTTTGGGGTTATGCGATGCCGATCCGCCCGCCAGGCTCGACACAGCCATTGGCCAAGATTATAGTG
TTTCTGAGGCCATCGATGCATATATTCGGGCGGCTCGGACGCATGGCTGGCAAGTCCCGGCCGACGTTGCACAAA
TAAGTCGAGGCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail