Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1306
Gene name
LocationContig_1386:383..1645
Strand+
Gene length (bp)1262
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18261 Rpn9_C Rpn9 C-terminal helix 8.1E-16 341 373
PF01399 PCI PCI domain 4.1E-08 234 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US13|RPN9_SCHPO Probable 26S proteasome regulatory subunit rpn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn9 PE=3 SV=1 6 378 6.0E-104
sp|Q04062|RPN9_YEAST 26S proteasome regulatory subunit RPN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN9 PE=1 SV=1 3 378 2.0E-85
sp|B0BN93|PSD13_RAT 26S proteasome non-ATPase regulatory subunit 13 OS=Rattus norvegicus GN=Psmd13 PE=1 SV=1 3 376 4.0E-75
sp|Q9UNM6|PSD13_HUMAN 26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens GN=PSMD13 PE=1 SV=2 3 376 5.0E-75
sp|Q5E964|PSD13_BOVIN 26S proteasome non-ATPase regulatory subunit 13 OS=Bos taurus GN=PSMD13 PE=2 SV=1 3 376 3.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US13|RPN9_SCHPO Probable 26S proteasome regulatory subunit rpn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn9 PE=3 SV=1 6 378 6.0E-104
sp|Q04062|RPN9_YEAST 26S proteasome regulatory subunit RPN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN9 PE=1 SV=1 3 378 2.0E-85
sp|B0BN93|PSD13_RAT 26S proteasome non-ATPase regulatory subunit 13 OS=Rattus norvegicus GN=Psmd13 PE=1 SV=1 3 376 4.0E-75
sp|Q9UNM6|PSD13_HUMAN 26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens GN=PSMD13 PE=1 SV=2 3 376 5.0E-75
sp|Q5E964|PSD13_BOVIN 26S proteasome non-ATPase regulatory subunit 13 OS=Bos taurus GN=PSMD13 PE=2 SV=1 3 376 3.0E-74
sp|P84169|PSD13_CHICK 26S proteasome non-ATPase regulatory subunit 13 OS=Gallus gallus GN=PSMD13 PE=1 SV=1 3 376 4.0E-74
sp|Q9WVJ2|PSD13_MOUSE 26S proteasome non-ATPase regulatory subunit 13 OS=Mus musculus GN=Psmd13 PE=1 SV=1 3 376 9.0E-74
sp|Q54NQ0|PSD13_DICDI 26S proteasome non-ATPase regulatory subunit 13 OS=Dictyostelium discoideum GN=psmD13 PE=2 SV=1 24 358 4.0E-65
sp|Q8GYA6|PS13B_ARATH 26S proteasome non-ATPase regulatory subunit 13 homolog B OS=Arabidopsis thaliana GN=RPN9B PE=1 SV=1 6 379 1.0E-62
sp|Q8RWF0|PS13A_ARATH 26S proteasome non-ATPase regulatory subunit 13 homolog A OS=Arabidopsis thaliana GN=RPN9A PE=1 SV=1 6 379 3.0E-62
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5391
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1306 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5146
Ophiocordyceps camponoti-floridani Ophcf2|01801
Ophiocordyceps camponoti-rufipedis Ophun1|3264
Ophiocordyceps kimflemingae Ophio5|7914
Ophiocordyceps subramaniannii Hirsu2|5536

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1306
MTVEYFLAEQRDQAPDELQPLYLDFENFWERKLWHQLTDALARFFAHPSSASQRLPFYKNFILKFADKINQLKLV
SLALNAATQCKDDHERLAFLQSIAAKVDHQDSQDAFVFALVAVARVKLSLNELNGARKDLDTAEKILDLFDSVET
VVHANFYDASASYYHRKMDFANYYRTALLYLACVDLSSMSIQERRQRAYFLSVAALVSNSIYNFGELLLHPILDV
LAQSDGDAWLRKLLFAYNRGDLAAYNVLSDNISSNALLSEHSSQLQQKIYLAALTEAVFRRPPHDRAMTFATISH
ETKVRPDEIEHLIMKALSLGLLRGTIDQVESVAHITWVQPKVLDMQQISAMRRRLLNWDSNVDQLGNWIETAGKD
VWAA*
Coding >OphauG2|1306
ATGACTGTCGAATATTTCCTTGCTGAACAGCGTGATCAAGCTCCAGACGAGCTTCAGCCCCTCTATCTCGACTTT
GAGAACTTCTGGGAACGCAAGCTATGGCATCAGCTCACAGATGCCCTAGCCCGCTTCTTTGCCCATCCCTCCAGT
GCATCGCAACGGTTGCCCTTTTACAAGAACTTCATCTTAAAATTCGCCGACAAAATAAACCAACTTAAGCTCGTA
TCTTTGGCTCTAAATGCCGCTACACAATGCAAGGATGACCATGAGCGCCTTGCCTTTTTACAGTCTATCGCGGCC
AAAGTCGACCATCAAGATTCGCAGGATGCCTTCGTCTTCGCCCTAGTCGCCGTCGCACGGGTCAAACTAAGCTTG
AACGAGCTAAACGGAGCAAGGAAAGACCTTGACACGGCTGAGAAAATACTGGACTTATTTGATTCGGTCGAGACG
GTTGTTCATGCCAACTTTTATGATGCCAGCGCAAGCTACTATCATCGCAAAATGGATTTTGCCAATTATTACCGC
ACTGCTCTGCTCTACCTTGCCTGCGTTGACTTGTCGTCCATGTCAATTCAAGAACGCCGCCAGAGAGCCTATTTC
CTTAGTGTGGCCGCCCTCGTATCGAATAGCATATATAACTTTGGCGAGCTCCTCTTGCATCCAATTCTTGATGTT
CTAGCCCAGAGCGATGGCGACGCCTGGCTGCGAAAGCTTCTGTTTGCTTATAACCGAGGCGATCTTGCGGCATAC
AACGTGCTTTCCGATAATATATCCTCCAATGCACTACTCAGCGAGCACTCGAGCCAATTGCAACAGAAGATCTAC
CTTGCTGCTCTCACCGAAGCTGTCTTTCGCCGCCCACCCCATGATAGGGCCATGACTTTTGCGACCATTTCGCAT
GAGACTAAAGTAAGACCTGACGAAATTGAACATCTTATAATGAAAGCTCTCAGTCTTGGCCTCTTGCGCGGCACC
ATCGACCAGGTCGAAAGTGTCGCTCACATTACATGGGTTCAGCCCAAGGTGCTTGACATGCAGCAGATCAGCGCC
ATGCGCCGCCGCCTTCTCAACTGGGACTCCAACGTCGATCAACTTGGCAACTGGATCGAGACAGCTGGAAAGGAT
GTCTGGGCAGCGTAG
Transcript >OphauG2|1306
ATGACTGTCGAATATTTCCTTGCTGAACAGCGTGATCAAGCTCCAGACGAGCTTCAGCCCCTCTATCTCGACTTT
GAGAACTTCTGGGAACGCAAGCTATGGCATCAGCTCACAGATGCCCTAGCCCGCTTCTTTGCCCATCCCTCCAGT
GCATCGCAACGGTTGCCCTTTTACAAGAACTTCATCTTAAAATTCGCCGACAAAATAAACCAACTTAAGCTCGTA
TCTTTGGCTCTAAATGCCGCTACACAATGCAAGGATGACCATGAGCGCCTTGCCTTTTTACAGTCTATCGCGGCC
AAAGTCGACCATCAAGATTCGCAGGATGCCTTCGTCTTCGCCCTAGTCGCCGTCGCACGGGTCAAACTAAGCTTG
AACGAGCTAAACGGAGCAAGGAAAGACCTTGACACGGCTGAGAAAATACTGGACTTATTTGATTCGGTCGAGACG
GTTGTTCATGCCAACTTTTATGATGCCAGCGCAAGCTACTATCATCGCAAAATGGATTTTGCCAATTATTACCGC
ACTGCTCTGCTCTACCTTGCCTGCGTTGACTTGTCGTCCATGTCAATTCAAGAACGCCGCCAGAGAGCCTATTTC
CTTAGTGTGGCCGCCCTCGTATCGAATAGCATATATAACTTTGGCGAGCTCCTCTTGCATCCAATTCTTGATGTT
CTAGCCCAGAGCGATGGCGACGCCTGGCTGCGAAAGCTTCTGTTTGCTTATAACCGAGGCGATCTTGCGGCATAC
AACGTGCTTTCCGATAATATATCCTCCAATGCACTACTCAGCGAGCACTCGAGCCAATTGCAACAGAAGATCTAC
CTTGCTGCTCTCACCGAAGCTGTCTTTCGCCGCCCACCCCATGATAGGGCCATGACTTTTGCGACCATTTCGCAT
GAGACTAAAGTAAGACCTGACGAAATTGAACATCTTATAATGAAAGCTCTCAGTCTTGGCCTCTTGCGCGGCACC
ATCGACCAGGTCGAAAGTGTCGCTCACATTACATGGGTTCAGCCCAAGGTGCTTGACATGCAGCAGATCAGCGCC
ATGCGCCGCCGCCTTCTCAACTGGGACTCCAACGTCGATCAACTTGGCAACTGGATCGAGACAGCTGGAAAGGAT
GTCTGGGCAGCGTAG
Gene >OphauG2|1306
ATGACTGTCGAATATTTCCTTGCTGAACAGCGTGATCAAGCTCCAGACGAGCTTCAGCCCCTCTATCTCGACTTT
GAGAACTTCTGGGAACGCAAGCTATGGCATCAGCTCACAGATGCCCTAGCCCGCTTCTTTGCCCATCCCTCCAGT
GCATCGCAACGGTTGCCCTTTTACAAGAACTTCATCTTAAAATTCGCCGACAAAATAAACCAACTTAAGCTCGTA
TCTTTGGCTCTAAATGCCGCTACACAATGCAAGGGTACGTCGTTATCCCGCCGATATTATCTAACACTCGTGAGT
AATCTCGGTCATGCATTTCTCGCAGATGACCATGAGCGCCTTGCCTTTTTACAGTCTATCGCGGCCAAAGTCGAC
CATCAAGATTCGCAGGATGCCTTCGTCTTCGCCCTAGTCGCCGTCGCACGGGTCAAACTAAGCTTGAACGAGCTA
AACGGAGCAAGGAAAGACCTTGACACGGCTGAGAAAATACTGGACTTATTTGATTCGGTCGAGACGGTTGTTCAT
GCCAACTTTTATGATGCCAGCGCAAGCTACTATCATGTGCGTATTCTCGAGTTAATGTACGACTTGTCACTGACG
TTTTTTCTGGTCCAAAGCGCAAAATGGATTTTGCCAATTATTACCGCACTGCTCTGCTCTACCTTGCCTGCGTTG
ACTTGTCGTCCATGTCAATTCAAGAACGCCGCCAGAGAGCCTATTTCCTTAGTGTGGCCGCCCTCGTATCGAATA
GCATATATAACTTTGGCGAGCTCCTCTTGCATCCAATTCTTGATGTTCTAGCCCAGAGCGATGGCGACGCCTGGC
TGCGAAAGCTTCTGTTTGCTTATAACCGAGGCGATCTTGCGGCATACAACGTGCTTTCCGATAATATATCCTCCA
ATGCACTACTCAGCGAGCACTCGAGCCAATTGCAACAGAAGATCTACCTTGCTGCTCTCACCGAAGCTGTCTTTC
GCCGCCCACCCCATGATAGGGCCATGACTTTTGCGACCATTTCGCATGAGACTAAAGTAAGACCTGACGAAATTG
AACATCTTATAATGAAAGCTCTCAGTCTTGGCCTCTTGCGCGGCACCATCGACCAGGTCGAAAGTGTCGCTCACA
TTACATGGGTTCAGCCCAAGGTGCTTGACATGCAGCAGATCAGCGCCATGCGCCGCCGCCTTCTCAACTGGGACT
CCAACGTCGATCAACTTGGCAACTGGATCGAGACAGCTGGAAAGGATGTCTGGGCAGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail