Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1299
Gene name
LocationContig_1382:1510..2535
Strand-
Gene length (bp)1025
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01015 Ribosomal_S3Ae Ribosomal S3Ae family 1.8E-79 17 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YTD6|RS3A_NECH7 40S ribosomal protein S1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RPS1 PE=3 SV=1 1 256 2.0E-175
sp|Q871N9|RS3A_NEUCR 40S ribosomal protein S1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps1 PE=3 SV=1 1 256 2.0E-168
sp|B6HFE0|RS3A_PENRW 40S ribosomal protein S1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rps1 PE=3 SV=1 1 256 7.0E-168
sp|Q2UTI8|RS3A_ASPOR 40S ribosomal protein S1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rps1 PE=3 SV=1 1 256 1.0E-165
sp|B8NSD4|RS3A_ASPFN 40S ribosomal protein S1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rps1 PE=3 SV=1 1 256 1.0E-165
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YTD6|RS3A_NECH7 40S ribosomal protein S1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RPS1 PE=3 SV=1 1 256 2.0E-175
sp|Q871N9|RS3A_NEUCR 40S ribosomal protein S1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps1 PE=3 SV=1 1 256 2.0E-168
sp|B6HFE0|RS3A_PENRW 40S ribosomal protein S1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rps1 PE=3 SV=1 1 256 7.0E-168
sp|Q2UTI8|RS3A_ASPOR 40S ribosomal protein S1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rps1 PE=3 SV=1 1 256 1.0E-165
sp|B8NSD4|RS3A_ASPFN 40S ribosomal protein S1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rps1 PE=3 SV=1 1 256 1.0E-165
sp|Q0CA00|RS3A_ASPTN 40S ribosomal protein S1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rps1 PE=3 SV=1 1 256 4.0E-165
sp|A6RZS5|RS3A_BOTFB 40S ribosomal protein S1 OS=Botryotinia fuckeliana (strain B05.10) GN=rps1 PE=3 SV=1 1 256 4.0E-165
sp|A1C4N6|RS3A_ASPCL 40S ribosomal protein S1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rps1 PE=3 SV=1 1 256 1.0E-164
sp|A7E4H3|RS3A_SCLS1 40S ribosomal protein S1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rps1 PE=3 SV=1 1 256 2.0E-164
sp|Q5AS60|RS3A_EMENI 40S ribosomal protein S1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rps1 PE=3 SV=1 1 256 5.0E-164
sp|L7IK19|RS3A_MAGOY 40S ribosomal protein S1 OS=Magnaporthe oryzae (strain Y34) GN=RPS1 PE=2 SV=1 1 256 7.0E-164
sp|D4NXE7|RS3A_MAGO7 40S ribosomal protein S1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RPS1 PE=2 SV=2 1 256 7.0E-164
sp|A2R9S1|RS3A_ASPNC 40S ribosomal protein S1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rps1 PE=3 SV=1 1 256 8.0E-164
sp|Q2GW51|RS3A_CHAGB 40S ribosomal protein S1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RPS1 PE=3 SV=2 1 256 1.0E-163
sp|A1CZL7|RS3A_NEOFI 40S ribosomal protein S1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rps1 PE=3 SV=1 1 256 3.0E-163
sp|Q4WTM9|RS3A_ASPFU 40S ribosomal protein S1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rps1 PE=3 SV=1 1 256 3.0E-163
sp|B0Y356|RS3A_ASPFC 40S ribosomal protein S1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rps1 PE=3 SV=1 1 256 3.0E-163
sp|B6QGS2|RS3A_TALMQ 40S ribosomal protein S1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rps1 PE=3 SV=1 1 256 5.0E-161
sp|B8MBY6|RS3A_TALSN 40S ribosomal protein S1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rps1 PE=3 SV=1 1 256 8.0E-161
sp|Q0UFP1|RS3A_PHANO 40S ribosomal protein S1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RPS1 PE=3 SV=1 1 256 1.0E-158
sp|A6R9C3|RS3A_AJECN 40S ribosomal protein S1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RPS1 PE=3 SV=1 1 256 7.0E-157
sp|C0P0F6|RS3A_AJECG 40S ribosomal protein S1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=RPS1 PE=3 SV=1 1 256 2.0E-156
sp|C0SH35|RS3A_PARBP 40S ribosomal protein S1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=RPS1 PE=3 SV=2 1 256 2.0E-156
sp|C1GGT8|RS3A_PARBD 40S ribosomal protein S1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=RPS1 PE=3 SV=1 1 256 2.0E-156
sp|C1HDW2|RS3A_PARBA 40S ribosomal protein S1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=RPS1 PE=3 SV=1 1 256 2.0E-156
sp|C5FIC5|RS3A_ARTOC 40S ribosomal protein S1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RPS1 PE=3 SV=1 1 256 4.0E-156
sp|C5JZ38|RS3A_AJEDS 40S ribosomal protein S1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=RPS1 PE=3 SV=1 1 256 4.0E-156
sp|C5GS07|RS3A_AJEDR 40S ribosomal protein S1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RPS1 PE=3 SV=1 1 256 4.0E-156
sp|C6HGN3|RS3A_AJECH 40S ribosomal protein S1 OS=Ajellomyces capsulatus (strain H143) GN=RPS1 PE=3 SV=2 1 256 1.0E-155
sp|B2VUE4|RS3A_PYRTR 40S ribosomal protein S1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rps1 PE=3 SV=1 1 256 6.0E-155
sp|C5P7X2|RS3A_COCP7 40S ribosomal protein S1 OS=Coccidioides posadasii (strain C735) GN=RPS1 PE=3 SV=1 1 256 2.0E-145
sp|Q1DTL7|RS3A_COCIM 40S ribosomal protein S1 OS=Coccidioides immitis (strain RS) GN=RPS1 PE=3 SV=1 1 256 2.0E-145
sp|C4JMJ4|RS3A_UNCRE 40S ribosomal protein S1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=RPS1 PE=3 SV=2 1 256 3.0E-145
sp|Q6C2R9|RS3A_YARLI 40S ribosomal protein S1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS1 PE=3 SV=2 1 256 5.0E-143
sp|B9W790|RS3A_CANDC 40S ribosomal protein S1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RPS1 PE=3 SV=1 1 256 2.0E-137
sp|P0CC07|RS3A_CANAW 40S ribosomal protein S1 OS=Candida albicans (strain WO-1) GN=RPS1 PE=3 SV=1 1 256 2.0E-137
sp|P40910|RS3A_CANAL 40S ribosomal protein S1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS1 PE=3 SV=3 1 256 2.0E-137
sp|A3LX67|RS3A2_PICST 40S ribosomal protein S1-B OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RPS1B PE=3 SV=1 1 256 2.0E-137
sp|C5ME52|RS3A_CANTT 40S ribosomal protein S1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RPS1 PE=3 SV=1 1 256 4.0E-136
sp|A3LUW5|RS3A1_PICST 40S ribosomal protein S1-A OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RPS1A PE=3 SV=1 1 256 9.0E-136
sp|C4R853|RS3A_PICPG 40S ribosomal protein S1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RPS1 PE=3 SV=1 1 256 1.0E-133
sp|C4XYD5|RS3A1_CLAL4 40S ribosomal protein S1-A OS=Clavispora lusitaniae (strain ATCC 42720) GN=RPS1A PE=3 SV=1 1 256 3.0E-133
sp|B2B5P2|RS3A_PODAN 40S ribosomal protein S1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RPS1 PE=3 SV=1 1 210 3.0E-133
sp|A5DN58|RS3A_PICGU 40S ribosomal protein S1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPS1 PE=3 SV=1 1 256 4.0E-133
sp|Q6BLZ2|RS3A2_DEBHA 40S ribosomal protein S1-B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS1B PE=3 SV=1 1 256 4.0E-133
sp|C4XZU6|RS3A2_CLAL4 40S ribosomal protein S1-B OS=Clavispora lusitaniae (strain ATCC 42720) GN=RPS1B PE=3 SV=1 1 256 6.0E-133
sp|Q6BSE4|RS3A1_DEBHA 40S ribosomal protein S1-A OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS1A PE=3 SV=1 1 256 8.0E-133
sp|P33442|RS3A1_YEAST 40S ribosomal protein S1-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS1A PE=1 SV=2 1 256 2.0E-131
sp|A7A1W1|RS3A1_YEAS7 40S ribosomal protein S1-A OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS1A PE=3 SV=1 1 256 2.0E-131
sp|B5VNY0|RS3A1_YEAS6 40S ribosomal protein S1-A OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RPS1A PE=3 SV=1 1 256 2.0E-131
sp|C7GSL4|RS3A1_YEAS2 40S ribosomal protein S1-A OS=Saccharomyces cerevisiae (strain JAY291) GN=RPS1A PE=3 SV=1 1 256 2.0E-131
sp|B3RHV0|RS3A1_YEAS1 40S ribosomal protein S1-A OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RPS1A PE=3 SV=1 1 256 2.0E-131
sp|Q756Y3|RS3A_ASHGO 40S ribosomal protein S1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS1 PE=3 SV=1 1 256 2.0E-130
sp|Q764D2|RS3A_LENED 40S ribosomal protein S1 OS=Lentinula edodes GN=RPS1 PE=2 SV=1 1 250 4.0E-129
sp|Q6FK63|RS3A_CANGA 40S ribosomal protein S1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS1 PE=3 SV=1 1 256 8.0E-129
sp|C5DFM0|RS3A_LACTC 40S ribosomal protein S1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RPS1 PE=3 SV=1 1 256 9.0E-129
sp|B0CY45|RS3A_LACBS 40S ribosomal protein S1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RPS1 PE=3 SV=2 1 250 5.0E-128
sp|B6JWF7|RS3A_SCHJY 40S ribosomal protein S1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps1 PE=3 SV=1 1 244 3.0E-127
sp|A7TNP9|RS3A_VANPO 40S ribosomal protein S1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RPS1 PE=3 SV=1 1 256 3.0E-127
sp|A8NX92|RS3A_COPC7 40S ribosomal protein S1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RPS1 PE=3 SV=1 1 250 3.0E-127
sp|B8PIG4|RS3A_POSPM 40S ribosomal protein S1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=RPS1 PE=3 SV=1 1 250 5.0E-127
sp|P23248|RS3A2_YEAST 40S ribosomal protein S1-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS1B PE=1 SV=3 1 256 2.0E-126
sp|A6ZM02|RS3A2_YEAS7 40S ribosomal protein S1-B OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS1B PE=3 SV=1 1 256 2.0E-126
sp|B5VP69|RS3A2_YEAS6 40S ribosomal protein S1-B OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RPS1B PE=3 SV=1 1 256 2.0E-126
sp|B3LLJ2|RS3A2_YEAS1 40S ribosomal protein S1-B OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RPS1B PE=3 SV=1 1 256 2.0E-126
sp|Q09781|RS3A1_SCHPO 40S ribosomal protein S1-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps101 PE=3 SV=2 1 244 5.0E-126
sp|O94438|RS3A2_SCHPO 40S ribosomal protein S1-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps102 PE=1 SV=3 1 244 5.0E-126
sp|C7GVZ9|RS3A2_YEAS2 40S ribosomal protein S1-B OS=Saccharomyces cerevisiae (strain JAY291) GN=RPS1B PE=3 SV=1 1 256 5.0E-126
sp|Q6CWD0|RS3A_KLULA 40S ribosomal protein S1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS1 PE=1 SV=1 1 256 2.0E-125
sp|C5DS65|RS3A_ZYGRC 40S ribosomal protein S1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RPS1 PE=3 SV=1 1 256 2.0E-121
sp|A8QD49|RS3A_MALGO 40S ribosomal protein S1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=RPS1 PE=3 SV=1 1 252 2.0E-121
sp|Q4P4C2|RS3A_USTMA 40S ribosomal protein S1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RPS1 PE=3 SV=2 1 250 1.0E-119
sp|Q42262|RS3A2_ARATH 40S ribosomal protein S3a-2 OS=Arabidopsis thaliana GN=RPS3AB PE=2 SV=3 1 255 1.0E-118
sp|Q9CAV0|RS3A1_ARATH 40S ribosomal protein S3a-1 OS=Arabidopsis thaliana GN=RPS3AA PE=1 SV=3 1 255 5.0E-118
sp|P49397|RS3A_ORYSJ 40S ribosomal protein S3a OS=Oryza sativa subsp. japonica GN=RPS3A PE=2 SV=2 1 246 4.0E-117
sp|Q8GTE3|RS3A_CICAR 40S ribosomal protein S3a OS=Cicer arietinum PE=2 SV=1 1 253 2.0E-115
sp|Q285L8|RS3A_TOBAC 40S ribosomal protein S3a OS=Nicotiana tabacum GN=cyc07 PE=2 SV=1 1 252 6.0E-115
sp|P33444|RS3A_CATRO 40S ribosomal protein S3a OS=Catharanthus roseus GN=RPS3A PE=2 SV=4 1 252 9.0E-114
sp|A8HS48|RS3A_CHLRE 40S ribosomal protein S3a OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_168484 PE=3 SV=1 1 246 1.0E-113
sp|A5B4K1|RS3A1_VITVI 40S ribosomal protein S3a-1 OS=Vitis vinifera GN=GSVIVT00020038001 PE=3 SV=1 1 256 3.0E-113
sp|P49396|RS3A_BRACM 40S ribosomal protein S3a OS=Brassica campestris GN=RPS3A PE=2 SV=2 1 252 2.0E-112
sp|A5DVF8|RS3A_LODEL 40S ribosomal protein S1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RPS1 PE=3 SV=1 18 256 3.0E-112
sp|Q9MBB3|RS3A_DAUCA 40S ribosomal protein S3a OS=Daucus carota GN=cyc07 PE=2 SV=1 1 253 8.0E-112
sp|A7Q5X9|RS3A2_VITVI 40S ribosomal protein S3a-2 OS=Vitis vinifera GN=GSVIVT00031140001 PE=3 SV=1 1 229 9.0E-111
sp|P0CQ58|RS3A_CRYNJ 40S ribosomal protein S1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RPS1 PE=3 SV=1 1 244 2.0E-110
sp|P0CQ59|RS3A_CRYNB 40S ribosomal protein S1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RPS1 PE=3 SV=1 1 244 2.0E-110
sp|A4SAD2|RS3A_OSTLU 40S ribosomal protein S3a OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_28528 PE=3 SV=1 1 246 1.0E-108
sp|A7S3J7|RS3A_NEMVE 40S ribosomal protein S3a OS=Nematostella vectensis GN=v1g242621 PE=3 SV=1 1 237 4.0E-108
sp|P49198|RS3A_HELAN 40S ribosomal protein S3a OS=Helianthus annuus GN=RPS3A PE=2 SV=2 1 246 1.0E-107
sp|Q4T8S6|RS3A_TETNG 40S ribosomal protein S3a OS=Tetraodon nigroviridis GN=rps3a PE=3 SV=3 1 246 5.0E-104
sp|Q4KTD9|RS3A_SUBDO 40S ribosomal protein S3a OS=Suberites domuncula PE=2 SV=1 1 237 8.0E-104
sp|B5FZS9|RS3A_TAEGU 40S ribosomal protein S3a OS=Taeniopygia guttata GN=RPS3A PE=2 SV=1 1 246 3.0E-103
sp|P97351|RS3A_MOUSE 40S ribosomal protein S3a OS=Mus musculus GN=Rps3a PE=1 SV=3 1 246 5.0E-103
sp|P49242|RS3A_RAT 40S ribosomal protein S3a OS=Rattus norvegicus GN=Rps3a PE=1 SV=2 1 246 5.0E-103
sp|A8E604|RS3AB_XENLA 40S ribosomal protein S3a-B OS=Xenopus laevis GN=rps3a-b PE=2 SV=1 1 246 5.0E-103
sp|Q642T2|RS3A_XENTR 40S ribosomal protein S3a OS=Xenopus tropicalis GN=rps3a PE=2 SV=3 1 246 7.0E-103
sp|A2Q0R8|RS3A_SOLSE 40S ribosomal protein S3a OS=Solea senegalensis GN=rps3a PE=2 SV=1 1 246 8.0E-103
sp|Q801S3|RS3AA_XENLA 40S ribosomal protein S3a-A OS=Xenopus laevis GN=rps3a-a PE=2 SV=3 1 246 1.0E-102
sp|Q98TX2|RS3A_OPHHA 40S ribosomal protein S3a OS=Ophiophagus hannah GN=RPS3A PE=2 SV=3 1 246 2.0E-102
sp|B5DGL6|RS3A_SALSA 40S ribosomal protein S3a OS=Salmo salar GN=rps3a PE=2 SV=1 1 246 3.0E-102
sp|O43999|RS3A_EIMTE 40S ribosomal protein S3a OS=Eimeria tenella PE=2 SV=3 1 246 5.0E-102
sp|P61247|RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 1 246 5.0E-102
sp|Q56JV9|RS3A_BOVIN 40S ribosomal protein S3a OS=Bos taurus GN=RPS3A PE=2 SV=3 1 246 5.0E-102
sp|Q6PBY1|RS3A_DANRE 40S ribosomal protein S3a OS=Danio rerio GN=rps3a PE=2 SV=3 1 246 9.0E-102
sp|Q6DV02|RS3A_GECJA 40S ribosomal protein S3a OS=Gecko japonicus GN=RPS3A PE=2 SV=3 1 246 2.0E-101
sp|Q4R4Z6|RS3A_MACFA 40S ribosomal protein S3a OS=Macaca fascicularis GN=RPS3A PE=2 SV=3 1 246 3.0E-101
sp|B0KW94|RS3A_CALJA 40S ribosomal protein S3a OS=Callithrix jacchus GN=RPS3A PE=3 SV=1 1 246 1.0E-99
sp|O73813|RS3A_ORYLA 40S ribosomal protein S3a OS=Oryzias latipes GN=rps3a PE=2 SV=3 1 246 3.0E-99
sp|P61246|RS3A_FELCA 40S ribosomal protein S3a (Fragment) OS=Felis catus GN=RPS3A PE=2 SV=1 5 246 9.0E-99
sp|Q5CP76|RS3A_CRYHO 40S ribosomal protein S3a OS=Cryptosporidium hominis GN=Chro.40360 PE=3 SV=1 1 247 5.0E-98
sp|B3S6Y0|RS3A_TRIAD 40S ribosomal protein S3a OS=Trichoplax adhaerens GN=TRIADDRAFT_36460 PE=3 SV=1 1 255 5.0E-97
sp|P49395|RS3A_APLCA 40S ribosomal protein S3a OS=Aplysia californica GN=RPS3A PE=3 SV=2 1 246 7.0E-97
sp|A7L6A0|RS3A_ARTSF 40S ribosomal protein S3a OS=Artemia franciscana PE=2 SV=1 1 237 9.0E-96
sp|Q4MYZ4|RS3A_THEPA 40S ribosomal protein S3a OS=Theileria parva GN=TP03_0697 PE=3 SV=1 1 254 2.0E-92
sp|Q9XEG7|RS3A_TORRU 40S ribosomal protein S3a OS=Tortula ruralis GN=RPS3A PE=2 SV=3 1 234 5.0E-92
sp|Q4UB86|RS3A_THEAN 40S ribosomal protein S3a OS=Theileria annulata GN=TA17795 PE=3 SV=1 1 254 1.0E-91
sp|Q5G5C4|RS3A_PERAM 40S ribosomal protein S3a OS=Periplaneta americana GN=Parcxpwex01 PE=2 SV=1 21 246 6.0E-91
sp|Q56FG9|RS3A_LYSTE 40S ribosomal protein S3a OS=Lysiphlebus testaceipes PE=2 SV=1 21 246 9.0E-91
sp|Q4PM31|RS3A_IXOSC 40S ribosomal protein S3a OS=Ixodes scapularis PE=2 SV=1 21 235 2.0E-90
sp|Q95V35|RS3A_SPOFR 40S ribosomal protein S3a OS=Spodoptera frugiperda PE=2 SV=1 21 242 2.0E-89
sp|A5JSW9|RS3A_BOMMA 40S ribosomal protein S3a OS=Bombyx mandarina PE=2 SV=1 21 246 5.0E-89
sp|A8XSX8|RS3A_CAEBR 40S ribosomal protein S3a OS=Caenorhabditis briggsae GN=rps-1 PE=3 SV=1 21 256 3.0E-88
sp|Q1HRR3|RS3A_AEDAE 40S ribosomal protein S3a OS=Aedes aegypti GN=AAEL005901 PE=2 SV=1 21 237 8.0E-88
sp|A9USH8|RS3A_MONBE 40S ribosomal protein S3a OS=Monosiga brevicollis GN=34920 PE=3 SV=1 21 250 9.0E-88
sp|P48154|RS3A_CAEEL 40S ribosomal protein S3a OS=Caenorhabditis elegans GN=rps-1 PE=3 SV=2 21 256 1.0E-87
sp|A6YPJ8|RS3A_TRIIF 40S ribosomal protein S3a OS=Triatoma infestans PE=2 SV=1 22 246 1.0E-87
sp|A8PJ38|RS3A_BRUMA 40S ribosomal protein S3a OS=Brugia malayi GN=Bm1_27225 PE=3 SV=1 22 246 5.0E-87
sp|A7AMD1|RS3A_BABBO 40S ribosomal protein S3a OS=Babesia bovis GN=BBOV_III001480 PE=3 SV=1 1 254 5.0E-87
sp|Q6EV04|RS3A_BIPLU 40S ribosomal protein S3a OS=Biphyllus lunatus PE=2 SV=1 22 245 8.0E-87
sp|B0WN96|RS3A_CULQU 40S ribosomal protein S3a OS=Culex quinquefasciatus GN=CPIJ008584 PE=3 SV=2 21 237 2.0E-86
sp|A5K7J8|RS3A_PLAVS 40S ribosomal protein S3a OS=Plasmodium vivax (strain Salvador I) GN=PVX_095080 PE=3 SV=1 1 245 6.0E-86
sp|B3L3W7|RS3A_PLAKH 40S ribosomal protein S3a OS=Plasmodium knowlesi (strain H) GN=PKH_081740 PE=3 SV=1 1 245 8.0E-86
sp|Q64FN2|RS3A_BOMMO 40S ribosomal protein S3a OS=Bombyx mori PE=2 SV=1 21 232 4.0E-85
sp|P55830|RS3A_DROME 40S ribosomal protein S3a OS=Drosophila melanogaster GN=RpS3A PE=1 SV=4 20 245 5.0E-84
sp|B3P9W1|RS3A_DROER 40S ribosomal protein S3a OS=Drosophila erecta GN=RpS3A PE=3 SV=1 20 245 5.0E-84
sp|B4MEW8|RS3A_DROVI 40S ribosomal protein S3a OS=Drosophila virilis GN=RpS3A PE=3 SV=1 20 237 6.0E-84
sp|B4NHI4|RS3A_DROWI 40S ribosomal protein S3a OS=Drosophila willistoni GN=RpS3A PE=3 SV=1 20 237 7.0E-84
sp|B3N1G9|RS3A_DROAN 40S ribosomal protein S3a OS=Drosophila ananassae GN=RpS3A PE=3 SV=1 20 237 7.0E-84
sp|Q29CU2|RS3A_DROPS 40S ribosomal protein S3a OS=Drosophila pseudoobscura pseudoobscura GN=RpS3A PE=3 SV=1 20 237 7.0E-84
sp|B4H9N7|RS3A_DROPE 40S ribosomal protein S3a OS=Drosophila persimilis GN=RpS3A PE=3 SV=1 20 237 7.0E-84
sp|B4IL76|RS3A_DROSE 40S ribosomal protein S3a OS=Drosophila sechellia GN=RpS3A PE=3 SV=1 20 245 8.0E-84
sp|B4L7F0|RS3A_DROMO 40S ribosomal protein S3a OS=Drosophila mojavensis GN=RpS3A PE=3 SV=1 20 237 1.0E-83
sp|Q7RM92|RS3A_PLAYO 40S ribosomal protein S3a OS=Plasmodium yoelii yoelii GN=PY02291 PE=3 SV=2 1 245 3.0E-83
sp|O97313|RS3A_PLAF7 40S ribosomal protein S3a OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P7.35 PE=1 SV=1 1 238 3.0E-83
sp|B4JZQ9|RS3A_DROGR 40S ribosomal protein S3a OS=Drosophila grimshawi GN=RpS3A PE=3 SV=1 20 237 6.0E-83
sp|P52813|RS3A_ANOGA 40S ribosomal protein S3a OS=Anopheles gambiae GN=RpS3A PE=2 SV=3 22 237 3.0E-82
sp|B6DDU1|RS3A_ANODA 40S ribosomal protein S3a OS=Anopheles darlingi PE=2 SV=1 22 237 3.0E-81
sp|Q5DAA3|RS3A_SCHJA 40S ribosomal protein S3a OS=Schistosoma japonicum GN=SJCHGC01275 PE=2 SV=1 20 246 6.0E-76
sp|Q54ZW5|RS3A_DICDI 40S ribosomal protein S3a OS=Dictyostelium discoideum GN=rps3a PE=3 SV=1 21 246 2.0E-70
sp|B2CAZ2|RS3A_TAESO 40S ribosomal protein S3a OS=Taenia solium PE=2 SV=1 20 256 2.0E-67
sp|Q23DE3|RS3A_TETTS 40S ribosomal protein S3a OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00047480 PE=1 SV=2 19 232 2.0E-67
sp|Q4D2R9|RS3A1_TRYCC 40S ribosomal protein S3a-1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503635.59 PE=3 SV=1 1 242 2.0E-65
sp|Q4DZ41|RS3A2_TRYCC 40S ribosomal protein S3a-2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511001.9 PE=3 SV=1 1 242 1.0E-64
sp|A4IAU0|RS3A1_LEIIN 40S ribosomal protein S3a-1 OS=Leishmania infantum GN=LinJ35.0500 PE=3 SV=1 1 233 4.0E-63
sp|Q4FX73|RS3A_LEIMA 40S ribosomal protein S3a OS=Leishmania major GN=LmjF.35.0400 PE=2 SV=1 1 233 1.0E-59
sp|A4IAU1|RS3A2_LEIIN 40S ribosomal protein S3a-2 OS=Leishmania infantum GN=LinJ35.0510 PE=3 SV=1 1 233 1.0E-59
sp|A4HM77|RS3A_LEIBR 40S ribosomal protein S3a OS=Leishmania braziliensis GN=LbrM34_V2.0430 PE=3 SV=1 1 233 3.0E-59
sp|C4VBI8|RS3A_NOSCE 40S ribosomal protein S1 OS=Nosema ceranae (strain BRL01) GN=RPS1 PE=3 SV=1 21 219 1.0E-44
sp|Q8SS05|RS3A_ENCCU 40S ribosomal protein S1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS1 PE=3 SV=2 22 220 3.0E-44
sp|Q9AW90|RS3A_GUITH 40S ribosomal protein S3a OS=Guillardia theta PE=3 SV=1 1 220 1.0E-38
sp|A8BS79|RS3A_GIAIC 40S ribosomal protein S3a OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_16265 PE=3 SV=1 1 246 3.0E-37
sp|C6A3X6|RS3A_THESM 30S ribosomal protein S3Ae OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps3ae PE=3 SV=1 22 222 2.0E-26
sp|A1RSL5|RS3A_PYRIL 30S ribosomal protein S3Ae OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps3ae PE=3 SV=1 2 221 3.0E-25
sp|A0B5A7|RS3A_METTP 30S ribosomal protein S3Ae OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps3ae PE=3 SV=1 27 221 6.0E-25
sp|Q46AN4|RS3A_METBF 30S ribosomal protein S3Ae OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps3ae PE=3 SV=1 18 217 9.0E-25
sp|O27964|RS3A_ARCFU 30S ribosomal protein S3Ae OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps3ae PE=3 SV=1 22 221 2.0E-24
sp|O57803|RS3A_PYRHO 30S ribosomal protein S3Ae OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps3ae PE=3 SV=1 22 222 2.0E-24
sp|Q8TZE1|RS3A_PYRFU 30S ribosomal protein S3Ae OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps3ae PE=1 SV=1 20 222 3.0E-24
sp|Q5V296|RS3A_HALMA 30S ribosomal protein S3Ae OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps3ae PE=3 SV=1 26 217 4.0E-24
sp|Q8Q0F2|RS3A_METMA 30S ribosomal protein S3Ae OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps3ae PE=3 SV=1 18 217 4.0E-24
sp|Q18HQ7|RS3A_HALWD 30S ribosomal protein S3Ae OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps3ae PE=3 SV=1 29 221 5.0E-24
sp|B8D6D0|RS3A_DESK1 30S ribosomal protein S3Ae OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps3ae PE=3 SV=1 22 221 6.0E-24
sp|Q8TVD1|RS3A_METKA 30S ribosomal protein S3Ae OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps3ae PE=3 SV=1 22 221 8.0E-24
sp|Q8TKI9|RS3A_METAC 30S ribosomal protein S3Ae OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps3ae PE=3 SV=2 18 217 9.0E-24
sp|Q9V2K7|RS3A_PYRAB 30S ribosomal protein S3Ae OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps3ae PE=3 SV=2 22 222 1.0E-23
sp|B6YU65|RS3A_THEON 30S ribosomal protein S3Ae OS=Thermococcus onnurineus (strain NA1) GN=rps3ae PE=3 SV=1 20 222 4.0E-23
sp|B1YDC4|RS3A_PYRNV 30S ribosomal protein S3Ae OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps3ae PE=3 SV=1 2 221 5.0E-23
sp|C5A552|RS3A_THEGJ 30S ribosomal protein S3Ae OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps3ae PE=3 SV=1 22 222 7.0E-23
sp|Q5JGM4|RS3A_THEKO 30S ribosomal protein S3Ae OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps3ae PE=3 SV=1 22 221 8.0E-23
sp|A5UKY8|RS3A_METS3 30S ribosomal protein S3Ae OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps3ae PE=3 SV=1 12 218 1.0E-22
sp|B9LTT6|RS3A_HALLT 30S ribosomal protein S3Ae OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps3ae PE=3 SV=1 26 221 4.0E-22
sp|Q8ZT21|RS3A_PYRAE 30S ribosomal protein S3Ae OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps3ae PE=3 SV=1 2 221 1.0E-21
sp|O27630|RS3A_METTH 30S ribosomal protein S3Ae OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps3ae PE=3 SV=1 14 221 1.0E-21
sp|Q975F8|RS3A_SULTO 30S ribosomal protein S3Ae OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps3ae PE=3 SV=1 22 221 3.0E-21
sp|Q4JB17|RS3A_SULAC 30S ribosomal protein S3Ae OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps3ae PE=3 SV=1 22 222 8.0E-21
sp|C3NEB9|RS3A_SULIY 30S ribosomal protein S3Ae OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps3ae PE=3 SV=1 22 226 9.0E-21
sp|C3NHD3|RS3A_SULIN 30S ribosomal protein S3Ae OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps3ae PE=3 SV=1 22 226 9.0E-21
sp|C3MVF4|RS3A_SULIM 30S ribosomal protein S3Ae OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps3ae PE=3 SV=1 22 226 9.0E-21
sp|C3MQ36|RS3A_SULIL 30S ribosomal protein S3Ae OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps3ae PE=3 SV=1 22 226 9.0E-21
sp|C4KHD2|RS3A_SULIK 30S ribosomal protein S3Ae OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps3ae PE=3 SV=1 22 226 9.0E-21
sp|C3N5Q3|RS3A_SULIA 30S ribosomal protein S3Ae OS=Sulfolobus islandicus (strain M.16.27) GN=rps3ae PE=3 SV=1 22 226 9.0E-21
sp|A3MVE0|RS3A_PYRCJ 30S ribosomal protein S3Ae OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps3ae PE=3 SV=1 22 221 1.0E-20
sp|A6USE4|RS3A_METVS 30S ribosomal protein S3Ae OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps3ae PE=3 SV=1 8 222 2.0E-20
sp|Q3IQA0|RS3A_NATPD 30S ribosomal protein S3Ae OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps3ae PE=3 SV=1 27 217 2.0E-20
sp|Q9YCV8|RS3A_AERPE 30S ribosomal protein S3Ae OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps3ae PE=3 SV=2 22 221 5.0E-20
sp|B7XMD2|RS3A_ENTBH 40S ribosomal protein S1 OS=Enterocytozoon bieneusi (strain H348) GN=RPS1 PE=3 SV=1 3 219 1.0E-19
sp|A4WLY6|RS3A_PYRAR 30S ribosomal protein S3Ae OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps3ae PE=3 SV=1 2 221 1.0E-19
sp|Q9UXD4|RS3A_SULSO 30S ribosomal protein S3Ae OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps3ae PE=3 SV=1 22 226 1.0E-18
sp|A3DMT5|RS3A_STAMF 30S ribosomal protein S3Ae OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps3ae PE=3 SV=1 22 221 2.0E-18
sp|A9A7B4|RS3A_METM6 30S ribosomal protein S3Ae OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps3ae PE=3 SV=1 8 222 6.0E-18
sp|A6VJX5|RS3A_METM7 30S ribosomal protein S3Ae OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps3ae PE=3 SV=1 8 222 7.0E-18
sp|A4FYC7|RS3A_METM5 30S ribosomal protein S3Ae OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps3ae PE=3 SV=1 8 222 1.0E-17
sp|Q6LZG0|RS3A_METMP 30S ribosomal protein S3Ae OS=Methanococcus maripaludis (strain S2 / LL) GN=rps3ae PE=3 SV=1 8 222 1.0E-17
sp|Q9HRA5|RS3A_HALSA 30S ribosomal protein S3Ae OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps3ae PE=3 SV=1 27 217 4.0E-17
sp|B0R457|RS3A_HALS3 30S ribosomal protein S3Ae OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps3ae PE=3 SV=1 27 217 4.0E-17
sp|A8AAU3|RS3A_IGNH4 30S ribosomal protein S3Ae OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps3ae PE=3 SV=1 22 221 8.0E-16
sp|A3CSL0|RS3A_METMJ 30S ribosomal protein S3Ae OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps3ae PE=3 SV=1 27 217 8.0E-16
sp|P54059|RS3A_METJA 30S ribosomal protein S3Ae OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps3ae PE=3 SV=2 22 222 3.0E-15
sp|A7IAJ1|RS3A_METB6 30S ribosomal protein S3Ae OS=Methanoregula boonei (strain 6A8) GN=rps3ae PE=3 SV=1 12 217 5.0E-14
sp|B8GFN8|RS3A_METPE 30S ribosomal protein S3Ae OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps3ae PE=3 SV=1 21 217 7.0E-14
sp|Q6KYU3|RS3A_PICTO 30S ribosomal protein S3Ae OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps3ae PE=3 SV=1 20 218 5.0E-11
sp|Q978Z2|RS3A_THEVO 30S ribosomal protein S3Ae OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps3ae PE=3 SV=1 29 243 5.0E-11
sp|Q2FS35|RS3A_METHJ 30S ribosomal protein S3Ae OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps3ae PE=3 SV=1 21 217 3.0E-10
sp|Q9HJ08|RS3A_THEAC 30S ribosomal protein S3Ae OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps3ae PE=3 SV=1 29 218 2.0E-09
sp|A2SQ57|RS3A_METLZ 30S ribosomal protein S3Ae OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps3ae PE=3 SV=1 7 214 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5429
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1299 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5484
Ophiocordyceps camponoti-floridani Ophcf2|06076
Ophiocordyceps camponoti-rufipedis Ophun1|6585
Ophiocordyceps kimflemingae Ophio5|4094
Ophiocordyceps subramaniannii Hirsu2|5892

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1299
MAVGKNKRLSKGKKGLKKKTVDPFSRKDWYSIKAPSPFNIRDVGKTLVNRTTGLKNANDALKGRIVEVSLADLQK
DEDHAFRKVRLRVDEIQGKNCLTNFHGLDFTSDKLRSLVRKWQTLIEANVTVKTTDDYLIRLFAIAFTKRRPNQI
KKTTYAASSQIRAIRRKMTDIIQREASSCTLTQLTSKLIPEVIGREIEKSTHGIYPLQNVHIRKVKLLKTPKFDL
GALMALHGESGADDQGQKVEREFKETVLNEV*
Coding >OphauG2|1299
ATGGCAGTCGGAAAGAACAAGAGGCTTTCCAAGGGCAAAAAAGGCCTGAAGAAGAAGACTGTCGACCCATTTTCC
CGGAAAGACTGGTACTCGATCAAGGCCCCCAGCCCTTTTAATATTCGAGATGTCGGCAAGACTCTCGTCAATCGC
ACGACGGGTCTGAAGAATGCGAACGATGCCCTCAAGGGTCGAATTGTTGAAGTATCGCTCGCAGATCTTCAGAAG
GATGAAGATCATGCTTTCCGTAAAGTTCGTCTTCGGGTCGACGAGATTCAGGGCAAAAACTGCTTGACAAACTTC
CACGGTCTCGATTTCACCTCGGACAAGCTGCGATCTCTTGTTCGCAAGTGGCAGACCCTGATTGAGGCCAATGTT
ACTGTTAAAACAACCGACGACTATCTTATTCGTCTGTTCGCCATTGCGTTTACTAAAAGACGGCCCAATCAAATC
AAGAAGACAACATACGCAGCCTCATCACAGATTCGGGCGATTCGACGCAAGATGACGGATATAATTCAACGCGAG
GCCTCCAGCTGTACCCTCACTCAGCTCACGTCCAAACTGATCCCTGAGGTTATTGGCCGTGAGATTGAGAAATCC
ACGCATGGAATATACCCCCTCCAGAACGTGCACATTCGCAAGGTGAAGCTTCTCAAAACGCCAAAGTTCGATCTA
GGTGCGCTTATGGCTCTTCATGGTGAATCGGGTGCCGATGATCAGGGGCAGAAAGTCGAGAGAGAGTTCAAGGAG
ACTGTACTAAACGAGGTGTGA
Transcript >OphauG2|1299
ATGGCAGTCGGAAAGAACAAGAGGCTTTCCAAGGGCAAAAAAGGCCTGAAGAAGAAGACTGTCGACCCATTTTCC
CGGAAAGACTGGTACTCGATCAAGGCCCCCAGCCCTTTTAATATTCGAGATGTCGGCAAGACTCTCGTCAATCGC
ACGACGGGTCTGAAGAATGCGAACGATGCCCTCAAGGGTCGAATTGTTGAAGTATCGCTCGCAGATCTTCAGAAG
GATGAAGATCATGCTTTCCGTAAAGTTCGTCTTCGGGTCGACGAGATTCAGGGCAAAAACTGCTTGACAAACTTC
CACGGTCTCGATTTCACCTCGGACAAGCTGCGATCTCTTGTTCGCAAGTGGCAGACCCTGATTGAGGCCAATGTT
ACTGTTAAAACAACCGACGACTATCTTATTCGTCTGTTCGCCATTGCGTTTACTAAAAGACGGCCCAATCAAATC
AAGAAGACAACATACGCAGCCTCATCACAGATTCGGGCGATTCGACGCAAGATGACGGATATAATTCAACGCGAG
GCCTCCAGCTGTACCCTCACTCAGCTCACGTCCAAACTGATCCCTGAGGTTATTGGCCGTGAGATTGAGAAATCC
ACGCATGGAATATACCCCCTCCAGAACGTGCACATTCGCAAGGTGAAGCTTCTCAAAACGCCAAAGTTCGATCTA
GGTGCGCTTATGGCTCTTCATGGTGAATCGGGTGCCGATGATCAGGGGCAGAAAGTCGAGAGAGAGTTCAAGGAG
ACTGTACTAAACGAGGTGTGA
Gene >OphauG2|1299
ATGGCAGTCGGAAAGTTAGTGCCATATTTATATTGGTCTTTTAATGCACTCACTGACTTGGAGTAGGAACAAGAG
GCTTTCCAAGGGCAAAAAAGGCCTGAAGAAGAAGACTGTCGACCCATTTTCCCGGAAAGACTGGTACTCGATCAA
GGTAGGGTTATCTTGATGCGAATCATCTGCTACTCTTGTTCGCATGTTGATCAATCTTCTCTAGGCCCCCAGCCC
TTTTAATATTCGAGAGTGAGTCAAAATACGAAGAGAAACGGCCGATAATAAATATCAATTAGCTGACAAGGCGAA
TTGAAGTGTCGGCAAGACTCTCGTCAATCGCACGACGGGTCTGAAGAATGCGAACGATGCCCTCAAGGGTCGAAT
TGTTGAAGTATCGCTCGCAGATCTTCAGAAGGATGAAGATCATGCTTTCCGTAAAGTTCGTCTTCGGGTCGACGA
GATTCAGGGCAAAAACTGCTTGACAAACTTCCACGGTCTCGATTTCACCTCGGACAAGCTGCGATCTCTTGTTCG
CAAGTGGCAGACCCTGATTGAGGCCAATGTTACTGTTAAAACAACCGACGACTATCTTATTCGTCTGTTCGCCAT
TGCGTTTACTAAAAGACGGCCCAATCAAATCAAGAAGACAACATACGCAGCCTCATCACAGATTCGGGCGATTCG
ACGCAAGATGACGGATATAATTCAACGCGAGGCCTCCAGCTGTACCCTCACTCAGCTCACGTCCAAACTGATCCC
TGAGGTTATTGGCCGTGAGATTGAGAAATCCACGCATGGAATATACCCCCTCCAGAACGTAAGTGCATAAATGAT
CTCTTTGTTTGTATGCAACCTTTGCGCGTATGCAAATAAGAGCTAACCTCTTCTAGGTGCACATTCGCAAGGTGA
AGCTTCTCAAAACGCCAAAGTTCGATCTAGGTGCGCTTATGGCTCTTCATGGTGAATCGGGTGCCGATGATCAGG
GGCAGAAAGTCGAGAGAGAGTTCAAGGAGACTGTACTAAACGAGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail