Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1289
Gene name
LocationContig_138:14715..18354
Strand-
Gene length (bp)3639
Transcript length (bp)3474
Coding sequence length (bp)3474
Protein length (aa) 1158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00562 RNA_pol_Rpb2_6 RNA polymerase Rpb2, domain 6 2.0E-122 686 1062
PF04563 RNA_pol_Rpb2_1 RNA polymerase beta subunit 6.3E-54 43 418
PF04560 RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7 3.3E-32 1064 1149
PF04561 RNA_pol_Rpb2_2 RNA polymerase Rpb2, domain 2 8.9E-30 193 376
PF04566 RNA_pol_Rpb2_4 RNA polymerase Rpb2, domain 4 7.9E-22 557 618
PF04565 RNA_pol_Rpb2_3 RNA polymerase Rpb2, domain 3 2.0E-19 455 518
PF04567 RNA_pol_Rpb2_5 RNA polymerase Rpb2, domain 5 5.4E-08 639 674

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10233|RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc2 PE=2 SV=1 5 1155 0.0E+00
sp|P22276|RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RET1 PE=1 SV=2 5 1153 0.0E+00
sp|P59470|RPC2_MOUSE DNA-directed RNA polymerase III subunit RPC2 OS=Mus musculus GN=Polr3b PE=1 SV=2 19 1149 0.0E+00
sp|Q9NW08|RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens GN=POLR3B PE=1 SV=2 8 1149 0.0E+00
sp|P25167|RPC2_DROME DNA-directed RNA polymerase III subunit RPC2 OS=Drosophila melanogaster GN=RpIII128 PE=2 SV=2 5 1151 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10233|RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc2 PE=2 SV=1 5 1155 0.0E+00
sp|P22276|RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RET1 PE=1 SV=2 5 1153 0.0E+00
sp|P59470|RPC2_MOUSE DNA-directed RNA polymerase III subunit RPC2 OS=Mus musculus GN=Polr3b PE=1 SV=2 19 1149 0.0E+00
sp|Q9NW08|RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens GN=POLR3B PE=1 SV=2 8 1149 0.0E+00
sp|P25167|RPC2_DROME DNA-directed RNA polymerase III subunit RPC2 OS=Drosophila melanogaster GN=RpIII128 PE=2 SV=2 5 1151 0.0E+00
sp|F4KD38|NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana GN=NRPC2 PE=2 SV=1 15 1151 0.0E+00
sp|P31814|RPOB_THECE DNA-directed RNA polymerase subunit B OS=Thermococcus celer GN=rpoB PE=3 SV=1 27 1151 0.0E+00
sp|Q8SR75|RPB2_ENCCU DNA-directed RNA polymerase II subunit RPB2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB2 PE=3 SV=1 27 1151 0.0E+00
sp|Q54J75|RPB2_DICDI DNA-directed RNA polymerase II subunit rpb2 OS=Dictyostelium discoideum GN=polr2b PE=3 SV=1 27 1147 0.0E+00
sp|Q10578|RPB2_CAEEL DNA-directed RNA polymerase II subunit RPB2 OS=Caenorhabditis elegans GN=rpb-2 PE=2 SV=2 5 1150 0.0E+00
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc2 OS=Dictyostelium discoideum GN=polr3b PE=3 SV=1 506 1151 0.0E+00
sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens GN=POLR2B PE=1 SV=1 24 1147 0.0E+00
sp|Q8CFI7|RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus GN=Polr2b PE=1 SV=2 24 1147 0.0E+00
sp|P11513|RPOB_SULAC DNA-directed RNA polymerase subunit B OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoB PE=3 SV=2 29 1149 0.0E+00
sp|Q6FLD5|RPB2_CANGA DNA-directed RNA polymerase II subunit RPB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB2 PE=3 SV=1 27 1147 0.0E+00
sp|P08518|RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB2 PE=1 SV=2 27 1147 0.0E+00
sp|Q42877|RPB2_SOLLC DNA-directed RNA polymerase II subunit RPB2 OS=Solanum lycopersicum GN=RPB2 PE=2 SV=1 13 1151 0.0E+00
sp|P38420|NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana GN=NRPB2 PE=1 SV=2 27 1147 0.0E+00
sp|P08266|RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster GN=RpII140 PE=2 SV=2 28 1149 0.0E+00
sp|Q753Q4|RPB2_ASHGO DNA-directed RNA polymerase II subunit RPB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB2 PE=3 SV=1 27 1147 0.0E+00
sp|Q02061|RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb2 PE=1 SV=2 27 1147 0.0E+00
sp|A5DHT2|RPB2_PICGU DNA-directed RNA polymerase II subunit RPB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB2 PE=3 SV=3 27 1150 0.0E+00
sp|Q03587|RPOB_THEAC DNA-directed RNA polymerase subunit B OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoB PE=3 SV=1 33 1151 0.0E+00
sp|Q60181|RPOB1_METJA DNA-directed RNA polymerase subunit B' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoB1 PE=3 SV=1 556 1152 5.0E-169
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc2 OS=Dictyostelium discoideum GN=polr3b PE=3 SV=1 12 535 3.0E-162
sp|O27124|RPOB1_METTH DNA-directed RNA polymerase subunit B' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoB1 PE=3 SV=1 557 1151 6.0E-162
sp|Q7T6X7|RPO2_MIMIV DNA-directed RNA polymerase subunit 2 OS=Acanthamoeba polyphaga mimivirus GN=RPO2 PE=1 SV=2 28 1143 3.0E-161
sp|P09845|RPOB1_METTW DNA-directed RNA polymerase subunit B' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoB1 PE=3 SV=2 557 1151 3.0E-159
sp|O28392|RPOB1_ARCFU DNA-directed RNA polymerase subunit B' OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoB1 PE=4 SV=1 557 1152 5.0E-159
sp|P0CX03|RPOB1_HALSA DNA-directed RNA polymerase subunit B' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoB1 PE=3 SV=1 557 1151 9.0E-159
sp|B0R8D5|RPOB1_HALS3 DNA-directed RNA polymerase subunit B' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoB1 PE=1 SV=1 557 1151 9.0E-159
sp|Q197F1|RPB2_IIV3 Probable DNA-directed RNA polymerase II subunit RPB2 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-009R PE=3 SV=1 17 1149 5.0E-158
sp|P41557|RPOB1_METVS DNA-directed RNA polymerase subunit B' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoB1 PE=3 SV=2 549 1151 2.0E-156
sp|Q9LK40|NRPD2_ARATH DNA-directed RNA polymerases IV and V subunit 2 OS=Arabidopsis thaliana GN=NRPD2 PE=1 SV=1 37 1143 3.0E-149
sp|Q9LV32|RPD2B_ARATH DNA-directed RNA polymerase D subunit 2b OS=Arabidopsis thaliana GN=NRPD2b PE=2 SV=1 37 1143 5.0E-146
sp|Q91F97|RPB2_IIV6 Probable DNA-directed RNA polymerase II subunit RPB2 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-428L PE=3 SV=1 27 1151 1.0E-136
sp|Q54BM1|RPA2_DICDI DNA-directed RNA polymerase I subunit rpa2 OS=Dictyostelium discoideum GN=polr1b PE=3 SV=1 40 1149 3.0E-132
sp|P28365|RPA2_EUPOC DNA-directed RNA polymerase I subunit RPA2 OS=Euplotes octocarinatus GN=RPA2 PE=3 SV=2 106 1151 7.0E-131
sp|P70700|RPA2_MOUSE DNA-directed RNA polymerase I subunit RPA2 OS=Mus musculus GN=Polr1b PE=1 SV=2 19 1149 6.0E-130
sp|Q9H9Y6|RPA2_HUMAN DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens GN=POLR1B PE=1 SV=2 19 1149 1.0E-129
sp|Q5REE8|RPA2_PONAB DNA-directed RNA polymerase I subunit RPA2 OS=Pongo abelii GN=POLR1B PE=2 SV=1 19 1149 2.0E-129
sp|Q9P7X8|RPA2_SCHPO Probable DNA-directed RNA polymerase I subunit RPA2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa2 PE=3 SV=2 37 1105 4.0E-124
sp|O74633|RPA2_NEUCR DNA-directed RNA polymerase I subunit RPA2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acr-2 PE=1 SV=2 37 1107 1.0E-123
sp|Q75DS1|RPA2_ASHGO DNA-directed RNA polymerase I subunit RPA2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPA2 PE=3 SV=2 80 1105 3.0E-123
sp|P22138|RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA135 PE=1 SV=1 85 1105 9.0E-118
sp|Q6GZR3|RPB2_FRG3G Putative DNA-directed RNA polymerase II subunit RPB2 homolog OS=Frog virus 3 (isolate Goorha) GN=FV3-062L PE=3 SV=1 44 1148 2.0E-117
sp|F4I366|NRPA2_ARATH DNA-directed RNA polymerase I subunit 2 OS=Arabidopsis thaliana GN=NRPA2 PE=2 SV=1 25 1151 1.0E-116
sp|P20028|RPA2_DROME DNA-directed RNA polymerase I subunit RPA2 OS=Drosophila melanogaster GN=RpI135 PE=2 SV=2 80 1151 3.0E-110
sp|P0C8K2|RPB2_ASFK5 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-065 PE=3 SV=1 27 1105 2.0E-94
sp|P0C8K3|RPB2_ASFM2 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-061 PE=3 SV=1 27 1105 2.0E-93
sp|P0C8K5|RPB2_ASFWA DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-063 PE=3 SV=1 27 1105 3.0E-93
sp|P0C8K4|RPB2_ASFP4 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-065 PE=3 SV=1 27 1105 3.0E-93
sp|P42487|RPB2_ASFB7 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-053 PE=3 SV=1 27 1105 6.0E-93
sp|O54888|RPA2_RAT DNA-directed RNA polymerase I subunit RPA2 OS=Rattus norvegicus GN=Polr1b PE=1 SV=1 686 1149 2.0E-86
sp|P41558|RPOB2_METVS DNA-directed RNA polymerase subunit B'' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoB2 PE=3 SV=1 34 531 9.0E-74
sp|P16716|RP132_SHEVK DNA-directed RNA polymerase 132 kDa polypeptide (Fragment) OS=Sheeppox virus (strain KS-1) GN=RPO132 PE=3 SV=1 343 1154 5.0E-68
sp|Q9J544|RP132_FOWPN DNA-directed RNA polymerase 132 kDa polypeptide OS=Fowlpox virus (strain NVSL) GN=RPO132 PE=3 SV=1 343 1154 5.0E-66
sp|Q9JF79|RP132_VACCT DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Tian Tan) GN=RPO132 PE=3 SV=1 343 1154 3.0E-65
sp|Q58444|RPOB2_METJA DNA-directed RNA polymerase subunit B'' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoB2 PE=3 SV=1 33 527 4.0E-65
sp|Q775Q3|RP132_CAMPS DNA-directed RNA polymerase 132 kDa polypeptide OS=Camelpox virus (strain CMS) GN=RPO132 PE=3 SV=1 477 1154 7.0E-65
sp|Q8V2N1|RP132_CAMPM DNA-directed RNA polymerase 132 kDa polypeptide OS=Camelpox virus (strain M-96) GN=RPO132 PE=3 SV=1 477 1154 7.0E-65
sp|Q8JL90|RP132_ECTVM DNA-directed RNA polymerase 132 kDa polypeptide OS=Ectromelia virus (strain Moscow) GN=RPO132 PE=3 SV=1 477 1154 1.0E-64
sp|Q8V4V3|RP132_MONPV DNA-directed RNA polymerase 132 kDa polypeptide OS=Monkeypox virus GN=RPO132 PE=3 SV=1 477 1154 2.0E-64
sp|Q80DV1|RP132_CWPXG DNA-directed RNA polymerase 132 kDa polypeptide OS=Cowpox virus (strain GRI-90 / Grishak) GN=RPO132 PE=3 SV=1 477 1154 2.0E-64
sp|P33811|RP132_VAR67 DNA-directed RNA polymerase 133 kDa polypeptide OS=Variola virus (isolate Human/India/Ind3/1967) GN=RPO132 PE=3 SV=3 477 1154 2.0E-64
sp|P17474|RP132_CWPXB DNA-directed RNA polymerase 132 kDa polypeptide OS=Cowpox virus (strain Brighton Red) GN=RPO132 PE=3 SV=1 477 1154 3.0E-64
sp|Q76ZP7|RP132_VACCW DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Western Reserve) GN=RPO132 PE=1 SV=1 477 1154 4.0E-64
sp|P68694|RP132_VACCC DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Copenhagen) GN=RPO132 PE=3 SV=1 477 1154 4.0E-64
sp|O57230|RP132_VACCA DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Ankara) GN=RPO132 PE=3 SV=1 343 1154 9.0E-64
sp|Q6RZF8|RP132_RABPU DNA-directed RNA polymerase 132 kDa polypeptide OS=Rabbitpox virus (strain Utrecht) GN=RPO132 PE=3 SV=1 477 1154 1.0E-63
sp|P0CX04|RPOB2_HALSA DNA-directed RNA polymerase subunit B'' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoB2 PE=3 SV=1 28 545 2.0E-59
sp|B0R8D6|RPOB2_HALS3 DNA-directed RNA polymerase subunit B'' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoB2 PE=1 SV=1 28 545 2.0E-59
sp|O27123|RPOB2_METTH DNA-directed RNA polymerase subunit B'' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoB2 PE=3 SV=1 26 531 3.0E-58
sp|P09844|RPOB2_METTW DNA-directed RNA polymerase subunit B'' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoB2 PE=3 SV=1 28 531 1.0E-56
sp|Q49V52|RPOB_STAS1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoB PE=3 SV=1 28 1150 1.0E-56
sp|Q0I7L7|RPOB_SYNS3 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9311) GN=rpoB PE=3 SV=1 44 1145 2.0E-49
sp|A9BCH6|RPOB_PROM4 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9211) GN=rpoB PE=3 SV=1 44 1145 5.0E-48
sp|A4VSK2|RPOB_STRSY DNA-directed RNA polymerase subunit beta OS=Streptococcus suis (strain 05ZYH33) GN=rpoB PE=3 SV=1 364 1151 2.0E-47
sp|A4VYU3|RPOB_STRS2 DNA-directed RNA polymerase subunit beta OS=Streptococcus suis (strain 98HAH33) GN=rpoB PE=3 SV=1 364 1151 2.0E-47
sp|B1HMZ6|RPOB_LYSSC DNA-directed RNA polymerase subunit beta OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoB PE=3 SV=1 365 1152 3.0E-47
sp|A5VLL4|RPOB_LACRD DNA-directed RNA polymerase subunit beta OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoB PE=3 SV=1 732 1096 1.0E-46
sp|Q85FR7|RPOB_CYAME DNA-directed RNA polymerase subunit beta OS=Cyanidioschyzon merolae GN=rpoB PE=3 SV=1 104 1152 2.0E-46
sp|Q932F8|RPOB_STAAM DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|P60279|RPOB_STAAW DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MW2) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|A8YZP0|RPOB_STAAT DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|Q6GBU5|RPOB_STAAS DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|P60278|RPOB_STAAN DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain N315) GN=rpoB PE=1 SV=1 732 1152 2.0E-46
sp|A6QEJ4|RPOB_STAAE DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Newman) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|Q2YSB9|RPOB_STAAB DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|P47768|RPOB_STAA8 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoB PE=3 SV=2 732 1152 2.0E-46
sp|Q2FJ98|RPOB_STAA3 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300) GN=rpoB PE=3 SV=2 732 1152 2.0E-46
sp|A6TZ19|RPOB_STAA2 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH1) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|A7WYW7|RPOB_STAA1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|A5IQ96|RPOB_STAA9 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH9) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|Q8CQ84|RPOB_STAES DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoB PE=3 SV=1 732 1150 2.0E-46
sp|Q5HRL0|RPOB_STAEQ DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoB PE=3 SV=1 732 1150 2.0E-46
sp|Q4L3K3|RPOB_STAHJ DNA-directed RNA polymerase subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoB PE=3 SV=1 732 1152 2.0E-46
sp|Q6GJC6|RPOB_STAAR DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=rpoB PE=3 SV=1 732 1152 4.0E-46
sp|Q3AHX5|RPOB_SYNSC DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9605) GN=rpoB PE=3 SV=1 44 1145 4.0E-46
sp|O83269|RPOB_TREPA DNA-directed RNA polymerase subunit beta OS=Treponema pallidum (strain Nichols) GN=rpoB PE=3 SV=1 674 1094 4.0E-46
sp|Q5HID3|RPOB_STAAC DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain COL) GN=rpoB PE=3 SV=1 732 1152 6.0E-46
sp|B9DKV0|RPOB_STACT DNA-directed RNA polymerase subunit beta OS=Staphylococcus carnosus (strain TM300) GN=rpoB PE=3 SV=1 732 1152 3.0E-45
sp|Q6MRX6|RPOB_MYCMS DNA-directed RNA polymerase subunit beta OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoB PE=3 SV=1 750 1094 4.0E-45
sp|P56299|RPOB_CHLVU DNA-directed RNA polymerase subunit beta OS=Chlorella vulgaris GN=rpoB PE=3 SV=1 750 1141 9.0E-45
sp|B9E8Q5|RPOB_MACCJ DNA-directed RNA polymerase subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpoB PE=3 SV=1 732 1147 1.0E-44
sp|Q88XZ3|RPOB_LACPL DNA-directed RNA polymerase subunit beta OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoB PE=3 SV=2 750 1147 1.0E-44
sp|Q03PU9|RPOB_LACBA DNA-directed RNA polymerase subunit beta OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoB PE=3 SV=1 750 1147 2.0E-44
sp|B3QZH0|RPOB_PHYMT DNA-directed RNA polymerase subunit beta OS=Phytoplasma mali (strain AT) GN=rpoB PE=3 SV=1 644 1094 2.0E-44
sp|Q38UQ2|RPOB_LACSS DNA-directed RNA polymerase subunit beta OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoB PE=3 SV=1 732 1147 2.0E-44
sp|Q2ST48|RPOB_MYCCT DNA-directed RNA polymerase subunit beta OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoB PE=3 SV=1 750 1152 4.0E-44
sp|A4XI30|RPOB_CALS8 DNA-directed RNA polymerase subunit beta OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoB PE=3 SV=1 732 1151 6.0E-44
sp|C0ZIH0|RPOB_BREBN DNA-directed RNA polymerase subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpoB PE=3 SV=1 750 1152 9.0E-44
sp|Q73JJ7|RPOB_TREDE DNA-directed RNA polymerase subunit beta OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpoB PE=3 SV=1 674 1094 1.0E-43
sp|Q1GBM5|RPOB_LACDA DNA-directed RNA polymerase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoB PE=3 SV=1 750 1152 1.0E-43
sp|Q04C22|RPOB_LACDB DNA-directed RNA polymerase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoB PE=3 SV=2 750 1152 1.0E-43
sp|B9DSZ5|RPOB_STRU0 DNA-directed RNA polymerase subunit beta OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoB PE=3 SV=1 750 1152 1.0E-43
sp|Q03V60|RPOB_LEUMM DNA-directed RNA polymerase subunit beta OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoB PE=3 SV=1 750 1151 1.0E-43
sp|Q8E239|RPOB_STRA5 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoB PE=3 SV=1 750 1152 2.0E-43
sp|Q8E7J8|RPOB_STRA3 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoB PE=3 SV=1 750 1152 2.0E-43
sp|Q3K3L2|RPOB_STRA1 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoB PE=3 SV=1 750 1152 2.0E-43
sp|Q18CF1|RPOB_PEPD6 DNA-directed RNA polymerase subunit beta OS=Peptoclostridium difficile (strain 630) GN=rpoB PE=3 SV=1 754 1152 2.0E-43
sp|B1MVW8|RPOB_LEUCK DNA-directed RNA polymerase subunit beta OS=Leuconostoc citreum (strain KM20) GN=rpoB PE=3 SV=1 750 1151 2.0E-43
sp|Q5M2F5|RPOB_STRT2 DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoB PE=3 SV=1 750 1153 2.0E-43
sp|Q5LXV3|RPOB_STRT1 DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoB PE=3 SV=1 750 1153 2.0E-43
sp|Q03IK2|RPOB_STRTD DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoB PE=3 SV=1 750 1153 2.0E-43
sp|Q03EA9|RPOB_PEDPA DNA-directed RNA polymerase subunit beta OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoB PE=3 SV=1 750 1147 2.0E-43
sp|Q2NJ15|RPOB_AYWBP DNA-directed RNA polymerase subunit beta OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoB PE=3 SV=1 750 1147 3.0E-43
sp|C0MEE3|RPOB_STRS7 DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoB PE=3 SV=1 750 1152 3.0E-43
sp|Q3A9Q7|RPOB_CARHZ DNA-directed RNA polymerase subunit beta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoB PE=3 SV=1 750 1147 3.0E-43
sp|Q9A1U1|RPOB_STRP1 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M1 GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|Q1JJ23|RPOB_STRPD DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|Q8P2Y3|RPOB_STRP8 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|B4U047|RPOB_STREM DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|C0M7C8|RPOB_STRE4 DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|A8LC64|RPOB_FRASN DNA-directed RNA polymerase subunit beta OS=Frankia sp. (strain EAN1pec) GN=rpoB PE=3 SV=1 108 1151 4.0E-43
sp|Q5L405|RPOB_GEOKA DNA-directed RNA polymerase subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=rpoB PE=3 SV=1 732 1152 4.0E-43
sp|B5XJ72|RPOB_STRPZ DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|P0DF31|RPOB_STRPQ DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|Q48VR1|RPOB_STRPM DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|A2RC51|RPOB_STRPG DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|Q1J8X1|RPOB_STRPF DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|Q1JE20|RPOB_STRPB DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|Q5XE97|RPOB_STRP6 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|P0DF30|RPOB_STRP3 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoB PE=3 SV=1 750 1152 4.0E-43
sp|A3CKD3|RPOB_STRSV DNA-directed RNA polymerase subunit beta OS=Streptococcus sanguinis (strain SK36) GN=rpoB PE=3 SV=2 750 1152 4.0E-43
sp|A9NEL7|RPOB_ACHLI DNA-directed RNA polymerase subunit beta OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoB PE=3 SV=1 750 1147 4.0E-43
sp|A4IJI1|RPOB_GEOTN DNA-directed RNA polymerase subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoB PE=3 SV=1 732 1152 4.0E-43
sp|Q04E85|RPOB_OENOB DNA-directed RNA polymerase subunit beta OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoB PE=3 SV=1 750 1147 4.0E-43
sp|Q5FM97|RPOB_LACAC DNA-directed RNA polymerase subunit beta OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoB PE=3 SV=1 746 1147 5.0E-43
sp|B9MQG5|RPOB_CALBD DNA-directed RNA polymerase subunit beta OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpoB PE=3 SV=1 750 1151 5.0E-43
sp|Q2JFI5|RPOB_FRASC DNA-directed RNA polymerase subunit beta OS=Frankia sp. (strain CcI3) GN=rpoB PE=3 SV=1 8 1151 5.0E-43
sp|Q9Z9M2|RPOB_BACHD DNA-directed RNA polymerase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoB PE=3 SV=1 732 1147 6.0E-43
sp|A8YXJ8|RPOB_LACH4 DNA-directed RNA polymerase subunit beta OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoB PE=3 SV=1 746 1147 7.0E-43
sp|C1CA06|RPOB_STRP7 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain 70585) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|C1CTL4|RPOB_STRZT DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|C1CMQ8|RPOB_STRZP DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain P1031) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|Q8DNF0|RPOB_STRR6 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoB PE=3 SV=2 750 1152 8.0E-43
sp|B5E2F3|RPOB_STRP4 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|Q04IK6|RPOB_STRP2 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|B1I8R4|RPOB_STRPI DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|B8ZNW7|RPOB_STRPJ DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|C1CGP4|RPOB_STRZJ DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain JJA) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|Q97NQ7|RPOB_STRPN DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoB PE=3 SV=1 750 1152 8.0E-43
sp|A8AZI3|RPOB_STRGC DNA-directed RNA polymerase subunit beta OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoB PE=3 SV=1 750 1152 1.0E-42
sp|Q5WLS0|RPOB_BACSK DNA-directed RNA polymerase subunit beta OS=Bacillus clausii (strain KSM-K16) GN=rpoB PE=3 SV=1 732 1147 1.0E-42
sp|Q6YQW3|RPOB_ONYPE DNA-directed RNA polymerase subunit beta OS=Onion yellows phytoplasma (strain OY-M) GN=rpoB PE=3 SV=1 750 1147 2.0E-42
sp|Q9CEN6|RPOB_LACLA DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoB PE=3 SV=1 648 1147 2.0E-42
sp|Q1WVA5|RPOB_LACS1 DNA-directed RNA polymerase subunit beta OS=Lactobacillus salivarius (strain UCC118) GN=rpoB PE=3 SV=1 750 1147 2.0E-42
sp|Q8DS46|RPOB_STRMU DNA-directed RNA polymerase subunit beta OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoB PE=3 SV=1 750 1152 2.0E-42
sp|Q85FM7|RPOB_ADICA DNA-directed RNA polymerase subunit beta OS=Adiantum capillus-veneris GN=rpoB PE=2 SV=2 750 1153 2.0E-42
sp|C4KZQ4|RPOB_EXISA DNA-directed RNA polymerase subunit beta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpoB PE=3 SV=1 750 1152 2.0E-42
sp|Q02X59|RPOB_LACLS DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoB PE=3 SV=1 666 1147 2.0E-42
sp|A2RML9|RPOB_LACLM DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoB PE=3 SV=1 666 1147 2.0E-42
sp|P47767|RPOB_SPICI DNA-directed RNA polymerase subunit beta OS=Spiroplasma citri GN=rpoB PE=3 SV=1 750 1094 2.0E-42
sp|A2C4N2|RPOB_PROM1 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain NATL1A) GN=rpoB PE=3 SV=1 563 1151 2.0E-42
sp|Q65PB5|RPOB_BACLD DNA-directed RNA polymerase subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoB PE=3 SV=1 750 1152 2.0E-42
sp|A0T0R1|RPOB_THAPS DNA-directed RNA polymerase subunit beta OS=Thalassiosira pseudonana GN=rpoB PE=3 SV=1 750 1153 3.0E-42
sp|Q6F0L7|RPOB_MESFL DNA-directed RNA polymerase subunit beta OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoB PE=3 SV=1 750 1094 4.0E-42
sp|P37870|RPOB_BACSU DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) GN=rpoB PE=1 SV=2 732 1152 5.0E-42
sp|Q46J22|RPOB_PROMT DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain NATL2A) GN=rpoB PE=3 SV=1 563 1151 5.0E-42
sp|B3WAM8|RPOB_LACCB DNA-directed RNA polymerase subunit beta OS=Lactobacillus casei (strain BL23) GN=rpoB PE=3 SV=1 732 1147 5.0E-42
sp|Q034X0|RPOB_LACC3 DNA-directed RNA polymerase subunit beta OS=Lactobacillus casei (strain ATCC 334) GN=rpoB PE=3 SV=1 732 1147 5.0E-42
sp|B0KCJ2|RPOB_THEP3 DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoB PE=3 SV=1 748 1151 6.0E-42
sp|Q8DL55|RPOB_THEEB DNA-directed RNA polymerase subunit beta OS=Thermosynechococcus elongatus (strain BP-1) GN=rpoB PE=3 SV=1 600 1148 6.0E-42
sp|Q4G3A7|RPOB_EMIHU DNA-directed RNA polymerase subunit beta OS=Emiliania huxleyi GN=rpoB PE=3 SV=1 750 1094 7.0E-42
sp|B1VAM6|RPOB_PHYAS DNA-directed RNA polymerase subunit beta OS=Phytoplasma australiense GN=rpoB PE=3 SV=1 750 1147 7.0E-42
sp|Q046D2|RPOB_LACGA DNA-directed RNA polymerase subunit beta OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoB PE=3 SV=1 750 1147 7.0E-42
sp|Q8R7U6|RPOB_CALS4 DNA-directed RNA polymerase subunit beta OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoB PE=3 SV=1 748 1151 8.0E-42
sp|Q72HM5|RPOB_THET2 DNA-directed RNA polymerase subunit beta OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoB PE=3 SV=1 751 1154 8.0E-42
sp|Q8RQE9|RPOB_THET8 DNA-directed RNA polymerase subunit beta OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoB PE=1 SV=1 751 1154 9.0E-42
sp|Q74L95|RPOB_LACJO DNA-directed RNA polymerase subunit beta OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoB PE=3 SV=1 750 1147 9.0E-42
sp|Q6B8R8|RPOB_GRATL DNA-directed RNA polymerase subunit beta OS=Gracilaria tenuistipitata var. liui GN=rpoB PE=3 SV=1 651 1151 1.0E-41
sp|B5RRJ7|RPOB_BORRA DNA-directed RNA polymerase subunit beta OS=Borrelia recurrentis (strain A1) GN=rpoB PE=3 SV=1 748 1094 1.0E-41
sp|B5RLU9|RPOB_BORDL DNA-directed RNA polymerase subunit beta OS=Borrelia duttonii (strain Ly) GN=rpoB PE=3 SV=1 748 1094 1.0E-41
sp|A8F976|RPOB_BACP2 DNA-directed RNA polymerase subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=rpoB PE=3 SV=1 750 1152 2.0E-41
sp|B2S092|RPOB_BORHD DNA-directed RNA polymerase subunit beta OS=Borrelia hermsii (strain HS1 / DAH) GN=rpoB PE=3 SV=1 748 1094 2.0E-41
sp|A7Z0M9|RPOB_BACMF DNA-directed RNA polymerase subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoB PE=3 SV=1 732 1152 2.0E-41
sp|Q9TL06|RPOB_NEPOL DNA-directed RNA polymerase subunit beta OS=Nephroselmis olivacea GN=rpoB PE=3 SV=1 750 1145 2.0E-41
sp|A3DIZ4|RPOB_CLOTH DNA-directed RNA polymerase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoB PE=3 SV=1 750 1152 2.0E-41
sp|Q8GCR6|RPOB1_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 732 1147 3.0E-41
sp|Q1JNX8|RPOB_STRPC DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoB PE=3 SV=2 750 1152 3.0E-41
sp|Q4A5S7|RPOB_MYCS5 DNA-directed RNA polymerase subunit beta OS=Mycoplasma synoviae (strain 53) GN=rpoB PE=3 SV=2 750 1094 3.0E-41
sp|Q8GCR3|RPOB4_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 732 1147 4.0E-41
sp|B0K5G8|RPOB_THEPX DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter sp. (strain X514) GN=rpoB PE=3 SV=1 748 1151 4.0E-41
sp|A1QZH7|RPOB_BORT9 DNA-directed RNA polymerase subunit beta OS=Borrelia turicatae (strain 91E135) GN=rpoB PE=3 SV=1 748 1094 4.0E-41
sp|Q250P0|RPOB_DESHY DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain Y51) GN=rpoB PE=3 SV=2 748 1147 4.0E-41
sp|A4J103|RPOB_DESRM DNA-directed RNA polymerase subunit beta OS=Desulfotomaculum reducens (strain MI-1) GN=rpoB PE=3 SV=1 750 1147 4.0E-41
sp|B8G1V8|RPOB_DESHD DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpoB PE=3 SV=1 748 1147 5.0E-41
sp|A2C6S8|RPOB_PROM3 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9303) GN=rpoB PE=3 SV=1 754 1145 5.0E-41
sp|Q7V5P1|RPOB_PROMM DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9313) GN=rpoB PE=3 SV=1 754 1145 5.0E-41
sp|Q2RFN9|RPOB_MOOTA DNA-directed RNA polymerase subunit beta OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoB PE=3 SV=1 750 1147 5.0E-41
sp|O78485|RPOB_GUITH DNA-directed RNA polymerase subunit beta OS=Guillardia theta GN=rpoB PE=3 SV=1 750 1145 5.0E-41
sp|Q1KVX5|RPOB2_ACUOB DNA-directed RNA polymerase subunit beta C-terminal section OS=Acutodesmus obliquus GN=rpoB2 PE=3 SV=1 698 1094 6.0E-41
sp|A5GNH3|RPOB_SYNPW DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain WH7803) GN=rpoB PE=3 SV=1 754 1145 6.0E-41
sp|Q82Z40|RPOB_ENTFA DNA-directed RNA polymerase subunit beta OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoB PE=3 SV=1 750 1147 7.0E-41
sp|Q9RVV9|RPOB_DEIRA DNA-directed RNA polymerase subunit beta OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpoB PE=3 SV=2 750 1147 7.0E-41
sp|P36440|RPOB_HETAK DNA-directed RNA polymerase subunit beta OS=Heterosigma akashiwo GN=rpoB PE=3 SV=1 675 1152 8.0E-41
sp|Q6HPR6|RPOB_BACHK DNA-directed RNA polymerase subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|Q63H98|RPOB_BACCZ DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|B9IZI6|RPOB_BACCQ DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain Q1) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|B7HQT6|RPOB_BACC7 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain AH187) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|C1ET31|RPOB_BACC3 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain 03BB102) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|Q73FA4|RPOB_BACC1 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|A0R8H2|RPOB_BACAH DNA-directed RNA polymerase subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoB PE=3 SV=2 732 1152 1.0E-40
sp|Q8GCR5|RPOB3_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 711 1147 1.0E-40
sp|P48119|RPOB_CYAPA DNA-directed RNA polymerase subunit beta OS=Cyanophora paradoxa GN=rpoB PE=3 SV=1 750 1145 1.0E-40
sp|Q9KWU7|RPOB_THEAQ DNA-directed RNA polymerase subunit beta OS=Thermus aquaticus GN=rpoB PE=1 SV=1 751 1154 1.0E-40
sp|Q6KI09|RPOB_MYCMO DNA-directed RNA polymerase subunit beta OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpoB PE=3 SV=1 750 1157 1.0E-40
sp|Q81VT8|RPOB_BACAN DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|C3LJ74|RPOB_BACAC DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|C3P9P7|RPOB_BACAA DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis (strain A0248) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|Q06J17|RPOB_BIGNA DNA-directed RNA polymerase subunit beta OS=Bigelowiella natans GN=rpoB PE=3 SV=1 749 1094 1.0E-40
sp|Q8HTL7|RPOB2_CHLRE DNA-directed RNA polymerase subunit beta C-terminal section OS=Chlamydomonas reinhardtii GN=rpoB2 PE=2 SV=1 750 1094 1.0E-40
sp|Q81J48|RPOB_BACCR DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|B7HJ40|RPOB_BACC4 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain B4264) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|B7IT11|RPOB_BACC2 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain G9842) GN=rpoB PE=3 SV=1 732 1152 1.0E-40
sp|A8MLD2|RPOB_ALKOO DNA-directed RNA polymerase subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoB PE=3 SV=1 750 1152 1.0E-40
sp|Q8GCR4|RPOB2_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 711 1147 2.0E-40
sp|Q67JT3|RPOB_SYMTH DNA-directed RNA polymerase subunit beta OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoB PE=3 SV=1 750 1147 2.0E-40
sp|Q7VA29|RPOB_PROMA DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpoB PE=3 SV=1 754 1145 3.0E-40
sp|Q9MUS5|RPOB_MESVI DNA-directed RNA polymerase subunit beta OS=Mesostigma viride GN=rpoB PE=3 SV=1 750 1145 3.0E-40
sp|Q3AZA4|RPOB_SYNS9 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9902) GN=rpoB PE=3 SV=1 664 1151 3.0E-40
sp|A9VP69|RPOB_BACWK DNA-directed RNA polymerase subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoB PE=3 SV=1 732 1147 4.0E-40
sp|P49466|RPOB_ODOSI DNA-directed RNA polymerase subunit beta OS=Odontella sinensis GN=rpoB PE=3 SV=1 749 1143 4.0E-40
sp|A6TWJ0|RPOB_ALKMQ DNA-directed RNA polymerase subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoB PE=3 SV=1 750 1152 4.0E-40
sp|Q8FS97|RPOB_COREF DNA-directed RNA polymerase subunit beta OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpoB PE=3 SV=1 24 1154 5.0E-40
sp|Q7U8K4|RPOB_SYNPX DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain WH8102) GN=rpoB PE=3 SV=1 754 1145 5.0E-40
sp|A0PXT8|RPOB_CLONN DNA-directed RNA polymerase subunit beta OS=Clostridium novyi (strain NT) GN=rpoB PE=3 SV=1 748 1147 5.0E-40
sp|Q31N17|RPOB_SYNE7 DNA-directed RNA polymerase subunit beta OS=Synechococcus elongatus (strain PCC 7942) GN=rpoB PE=3 SV=1 750 1141 6.0E-40
sp|Q8ETY8|RPOB_OCEIH DNA-directed RNA polymerase subunit beta OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoB PE=3 SV=1 732 1147 6.0E-40
sp|Q5MZ23|RPOB_SYNP6 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpoB PE=3 SV=1 750 1141 6.0E-40
sp|Q9RLT9|RPOB_LISMO DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoB PE=3 SV=1 750 1152 7.0E-40
sp|Q724F0|RPOB_LISMF DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoB PE=3 SV=1 750 1152 7.0E-40
sp|C1KYJ3|RPOB_LISMC DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpoB PE=3 SV=1 750 1152 7.0E-40
sp|A0AF63|RPOB_LISW6 DNA-directed RNA polymerase subunit beta OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoB PE=3 SV=1 750 1152 7.0E-40
sp|B8DEY8|RPOB_LISMH DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpoB PE=3 SV=1 750 1152 8.0E-40
sp|Q92F22|RPOB_LISIN DNA-directed RNA polymerase subunit beta OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoB PE=3 SV=1 750 1152 8.0E-40
sp|Q3M5D0|RPOB_ANAVT DNA-directed RNA polymerase subunit beta OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpoB PE=3 SV=1 750 1145 8.0E-40
sp|Q1J0P6|RPOB_DEIGD DNA-directed RNA polymerase subunit beta OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoB PE=3 SV=1 750 1147 8.0E-40
sp|A5USR7|RPOB_ROSS1 DNA-directed RNA polymerase subunit beta OS=Roseiflexus sp. (strain RS-1) GN=rpoB PE=3 SV=1 750 1154 9.0E-40
sp|Q661M9|RPOB_BORBP DNA-directed RNA polymerase subunit beta OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpoB PE=3 SV=1 761 1094 9.0E-40
sp|Q0AUH2|RPOB_SYNWW DNA-directed RNA polymerase subunit beta OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoB PE=3 SV=1 732 1152 9.0E-40
sp|A2BYL1|RPOB_PROM5 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9515) GN=rpoB PE=3 SV=1 754 1145 1.0E-39
sp|Q7V006|RPOB_PROMP DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpoB PE=3 SV=1 754 1145 1.0E-39
sp|Q19V98|RPOB_CHLAT DNA-directed RNA polymerase subunit beta OS=Chlorokybus atmophyticus GN=rpoB PE=3 SV=2 750 1145 1.0E-39
sp|A6MVX4|RPOB_RHDSA DNA-directed RNA polymerase subunit beta OS=Rhodomonas salina GN=rpoB PE=3 SV=1 657 1145 1.0E-39
sp|Q2JX64|RPOB_SYNJA DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpoB PE=3 SV=1 674 1148 1.0E-39
sp|A2BT61|RPOB_PROMS DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain AS9601) GN=rpoB PE=3 SV=1 664 1145 2.0E-39
sp|A3PEX4|RPOB_PROM0 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9301) GN=rpoB PE=3 SV=1 664 1145 2.0E-39
sp|B8G4U9|RPOB_CHLAD DNA-directed RNA polymerase subunit beta OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoB PE=3 SV=1 750 1154 2.0E-39
sp|Q6L3A7|RPOB_SACHY DNA-directed RNA polymerase subunit beta OS=Saccharum hybrid GN=rpoB PE=2 SV=2 174 1094 2.0E-39
sp|Q59191|RPOB_BORBU DNA-directed RNA polymerase subunit beta OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpoB PE=3 SV=2 761 1094 2.0E-39
sp|Q2JJ19|RPOB_SYNJB DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpoB PE=3 SV=1 674 1148 3.0E-39
sp|B7J1W1|RPOB_BORBZ DNA-directed RNA polymerase subunit beta OS=Borrelia burgdorferi (strain ZS7) GN=rpoB PE=3 SV=1 761 1094 3.0E-39
sp|A8G6Y6|RPOB_PROM2 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9215) GN=rpoB PE=3 SV=1 754 1145 3.0E-39
sp|Q318Q7|RPOB_PROM9 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9312) GN=rpoB PE=3 SV=1 664 1145 4.0E-39
sp|A0T0D7|RPOB_PHATC DNA-directed RNA polymerase subunit beta OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpoB PE=3 SV=1 746 1141 4.0E-39
sp|P51252|RPOB_PORPU DNA-directed RNA polymerase subunit beta OS=Porphyra purpurea GN=rpoB PE=3 SV=1 667 1094 5.0E-39
sp|A5GVF3|RPOB_SYNR3 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain RCC307) GN=rpoB PE=3 SV=2 754 1145 5.0E-39
sp|Q0SNB8|RPOB_BORAP DNA-directed RNA polymerase subunit beta OS=Borrelia afzelii (strain PKo) GN=rpoB PE=3 SV=1 761 1094 5.0E-39
sp|B9LL91|RPOB_CHLSY DNA-directed RNA polymerase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoB PE=3 SV=1 750 1154 6.0E-39
sp|A9WH12|RPOB_CHLAA DNA-directed RNA polymerase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoB PE=3 SV=1 750 1154 6.0E-39
sp|A5N4N9|RPOB_CLOK5 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoB PE=3 SV=1 750 1151 6.0E-39
sp|B9DYA1|RPOB_CLOK1 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain NBRC 12016) GN=rpoB PE=3 SV=1 750 1151 6.0E-39
sp|P0C503|RPOB_ORYSJ DNA-directed RNA polymerase subunit beta OS=Oryza sativa subsp. japonica GN=rpoB PE=3 SV=1 365 1094 6.0E-39
sp|P0C502|RPOB_ORYSI DNA-directed RNA polymerase subunit beta OS=Oryza sativa subsp. indica GN=rpoB PE=3 SV=1 365 1094 6.0E-39
sp|P0C501|RPOB_ORYSA DNA-directed RNA polymerase subunit beta OS=Oryza sativa GN=rpoB PE=3 SV=1 365 1094 6.0E-39
sp|Q6ENI4|RPOB_ORYNI DNA-directed RNA polymerase subunit beta OS=Oryza nivara GN=rpoB PE=3 SV=1 365 1094 6.0E-39
sp|Q98Q23|RPOB_MYCPU DNA-directed RNA polymerase subunit beta OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpoB PE=3 SV=1 750 1152 6.0E-39
sp|P77965|RPOB_SYNY3 DNA-directed RNA polymerase subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpoB PE=3 SV=1 693 1152 1.0E-38
sp|B2TIG8|RPOB_CLOBB DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoB PE=3 SV=1 750 1147 1.0E-38
sp|A6LPQ4|RPOB_CLOB8 DNA-directed RNA polymerase subunit beta OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoB PE=3 SV=1 734 1152 1.0E-38
sp|P22703|RPOB_NOSS1 DNA-directed RNA polymerase subunit beta OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpoB PE=3 SV=2 750 1145 1.0E-38
sp|Q6ENX3|RPOB_SACOF DNA-directed RNA polymerase subunit beta OS=Saccharum officinarum GN=rpoB PE=3 SV=1 365 1094 2.0E-38
sp|P16023|RPOB_MAIZE DNA-directed RNA polymerase subunit beta OS=Zea mays GN=rpoB PE=3 SV=1 365 1094 2.0E-38
sp|A1E9R4|RPOB_SORBI DNA-directed RNA polymerase subunit beta OS=Sorghum bicolor GN=rpoB PE=3 SV=1 365 1094 2.0E-38
sp|B2UYA3|RPOB_CLOBA DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoB PE=3 SV=1 750 1147 3.0E-38
sp|Q110H1|RPOB_TRIEI DNA-directed RNA polymerase subunit beta OS=Trichodesmium erythraeum (strain IMS101) GN=rpoB PE=3 SV=1 750 1141 3.0E-38
sp|A9B6J3|RPOB_HERA2 DNA-directed RNA polymerase subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoB PE=3 SV=1 750 1154 4.0E-38
sp|C1FMV9|RPOB_CLOBJ DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpoB PE=3 SV=1 750 1151 4.0E-38
sp|A7GJ82|RPOB_CLOBL DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoB PE=3 SV=1 750 1151 4.0E-38
sp|B1IGG2|RPOB_CLOBK DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoB PE=3 SV=1 750 1151 4.0E-38
sp|A5I7L4|RPOB_CLOBH DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoB PE=3 SV=1 750 1151 5.0E-38
sp|A7FZ77|RPOB_CLOB1 DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoB PE=3 SV=1 750 1151 5.0E-38
sp|C3KVQ9|RPOB_CLOB6 DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpoB PE=3 SV=1 750 1151 5.0E-38
sp|Q97EG9|RPOB_CLOAB DNA-directed RNA polymerase subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoB PE=3 SV=1 750 1147 5.0E-38
sp|Q4A969|RPOB_MYCHJ DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpoB PE=3 SV=1 750 1094 6.0E-38
sp|B1KSN3|RPOB_CLOBM DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoB PE=3 SV=1 750 1151 6.0E-38
sp|B0SAG1|RPOB_LEPBA DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpoB PE=3 SV=1 751 1138 7.0E-38
sp|B0SSI4|RPOB_LEPBP DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpoB PE=3 SV=1 751 1138 7.0E-38
sp|Q9KK59|RPOB_LEPBI DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa GN=rpoB PE=3 SV=1 751 1138 7.0E-38
sp|A6MM28|RPOB_BUXMI DNA-directed RNA polymerase subunit beta OS=Buxus microphylla GN=rpoB PE=3 SV=1 667 1094 9.0E-38
sp|Q1ACN6|RPOB_CHAVU DNA-directed RNA polymerase subunit beta OS=Chara vulgaris GN=rpoB PE=3 SV=2 754 1094 9.0E-38
sp|Q890N4|RPOB_CLOTE DNA-directed RNA polymerase subunit beta OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoB PE=3 SV=1 750 1151 9.0E-38
sp|Q9TM35|RPOB_CYACA DNA-directed RNA polymerase subunit beta OS=Cyanidium caldarium GN=rpoB PE=3 SV=1 750 1145 1.0E-37
sp|Q8RHI6|RPOB_FUSNN DNA-directed RNA polymerase subunit beta OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoB PE=3 SV=1 751 1152 1.0E-37
sp|Q85X54|RPOB_PINKO DNA-directed RNA polymerase subunit beta OS=Pinus koraiensis GN=rpoB PE=3 SV=1 750 1094 1.0E-37
sp|P41607|RPOB_PINTH DNA-directed RNA polymerase subunit beta OS=Pinus thunbergii GN=rpoB PE=3 SV=1 750 1094 2.0E-37
sp|Q32RW5|RPOB_STAPU DNA-directed RNA polymerase subunit beta OS=Staurastrum punctulatum GN=rpoB PE=3 SV=1 750 1094 2.0E-37
sp|A6W5T0|RPOB_KINRD DNA-directed RNA polymerase subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpoB PE=3 SV=1 364 1151 2.0E-37
sp|Q7NIA0|RPOB_GLOVI DNA-directed RNA polymerase subunit beta OS=Gloeobacter violaceus (strain PCC 7421) GN=rpoB PE=3 SV=1 608 1148 2.0E-37
sp|Q3BAP8|RPOB_PHAAO DNA-directed RNA polymerase subunit beta OS=Phalaenopsis aphrodite subsp. formosana GN=rpoB PE=3 SV=2 667 1094 4.0E-37
sp|Q5ZZS1|RPOB_MYCH2 DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain 232) GN=rpoB PE=3 SV=1 750 1094 5.0E-37
sp|Q4A7A9|RPOB_MYCH7 DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpoB PE=3 SV=1 750 1094 5.0E-37
sp|Q1XDN5|RPOB_PYRYE DNA-directed RNA polymerase subunit beta OS=Pyropia yezoensis GN=rpoB PE=3 SV=1 656 1094 7.0E-37
sp|Q1AU22|RPOB_RUBXD DNA-directed RNA polymerase subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpoB PE=3 SV=1 750 1146 1.0E-36
sp|Q73SE4|RPOB_MYCPA DNA-directed RNA polymerase subunit beta OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpoB PE=3 SV=2 750 1151 1.0E-36
sp|A0QL49|RPOB_MYCA1 DNA-directed RNA polymerase subunit beta OS=Mycobacterium avium (strain 104) GN=rpoB PE=3 SV=2 750 1151 1.0E-36
sp|A4QJS5|RPOB_OLIPU DNA-directed RNA polymerase subunit beta OS=Olimarabidopsis pumila GN=rpoB PE=3 SV=1 667 1094 1.0E-36
sp|A4QKI4|RPOB_CAPBU DNA-directed RNA polymerase subunit beta OS=Capsella bursa-pastoris GN=rpoB PE=3 SV=1 667 1094 2.0E-36
sp|P50546|RPOB_ARATH DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana GN=rpoB PE=3 SV=4 667 1094 2.0E-36
sp|A4QKS3|RPOB_CRUWA DNA-directed RNA polymerase subunit beta OS=Crucihimalaya wallichii GN=rpoB PE=3 SV=1 667 1094 2.0E-36
sp|Q2S1Q5|RPOB_SALRD DNA-directed RNA polymerase subunit beta OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoB PE=3 SV=2 901 1097 2.0E-36
sp|A4QL98|RPOB_LEPVR DNA-directed RNA polymerase subunit beta OS=Lepidium virginicum GN=rpoB PE=3 SV=1 667 1094 2.0E-36
sp|B0TC48|RPOB_HELMI DNA-directed RNA polymerase subunit beta OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoB PE=3 SV=1 750 1152 3.0E-36
sp|A4QK10|RPOB_ARAHI DNA-directed RNA polymerase subunit beta OS=Arabis hirsuta GN=rpoB PE=3 SV=1 750 1094 3.0E-36
sp|Q72UA8|RPOB_LEPIC DNA-directed RNA polymerase subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpoB PE=3 SV=1 751 1138 3.0E-36
sp|Q6EW56|RPOB_NYMAL DNA-directed RNA polymerase subunit beta OS=Nymphaea alba GN=rpoB PE=3 SV=1 667 1143 3.0E-36
sp|Q8F0S2|RPOB_LEPIN DNA-directed RNA polymerase subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpoB PE=3 SV=1 751 1138 3.0E-36
sp|P60282|RPOB_AMBTC DNA-directed RNA polymerase subunit beta OS=Amborella trichopoda GN=rpoB PE=3 SV=2 652 1146 3.0E-36
sp|Q0SQD6|RPOB_CLOPS DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoB PE=3 SV=1 750 1147 4.0E-36
sp|P0C2E7|RPOB_CLOPE DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain 13 / Type A) GN=rpoB PE=3 SV=1 750 1147 4.0E-36
sp|Q0TMN8|RPOB_CLOP1 DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoB PE=3 SV=1 750 1147 4.0E-36
sp|Q09X25|RPOB_MORIN DNA-directed RNA polymerase subunit beta OS=Morus indica GN=rpoB PE=3 SV=1 667 1094 4.0E-36
sp|Q054E2|RPOB_LEPBL DNA-directed RNA polymerase subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpoB PE=3 SV=1 751 1138 4.0E-36
sp|Q04QI9|RPOB_LEPBJ DNA-directed RNA polymerase subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpoB PE=3 SV=1 751 1138 4.0E-36
sp|A4QLI6|RPOB_LOBMA DNA-directed RNA polymerase subunit beta OS=Lobularia maritima GN=rpoB PE=3 SV=1 667 1094 4.0E-36
sp|Q5SCX8|RPOB_HUPLU DNA-directed RNA polymerase subunit beta OS=Huperzia lucidula GN=rpoB PE=3 SV=1 753 1094 4.0E-36
sp|P46818|RPOB_SINAL DNA-directed RNA polymerase subunit beta OS=Sinapis alba GN=rpoB PE=1 SV=2 750 1094 4.0E-36
sp|A6LKB8|RPOB_THEM4 DNA-directed RNA polymerase subunit beta OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoB PE=3 SV=1 750 1147 4.0E-36
sp|A4QK97|RPOB_BARVE DNA-directed RNA polymerase subunit beta OS=Barbarea verna GN=rpoB PE=3 SV=1 667 1094 5.0E-36
sp|A9L988|RPOB_LEMMI DNA-directed RNA polymerase subunit beta OS=Lemna minor GN=rpoB PE=3 SV=1 750 1094 5.0E-36
sp|Q09MI6|RPOB_CITSI DNA-directed RNA polymerase subunit beta OS=Citrus sinensis GN=rpoB PE=3 SV=1 750 1094 5.0E-36
sp|Q3V542|RPOB_ACOCL DNA-directed RNA polymerase subunit beta OS=Acorus calamus GN=rpoB PE=3 SV=2 667 1094 5.0E-36
sp|Q5QA72|RPOB_ACOGR DNA-directed RNA polymerase subunit beta OS=Acorus gramineus GN=rpoB PE=3 SV=1 667 1094 5.0E-36
sp|A4QLS5|RPOB_NASOF DNA-directed RNA polymerase subunit beta OS=Nasturtium officinale GN=rpoB PE=3 SV=1 667 1094 6.0E-36
sp|A1E9I1|RPOB_HORVU DNA-directed RNA polymerase subunit beta OS=Hordeum vulgare GN=rpoB PE=3 SV=1 750 1094 6.0E-36
sp|Q3ATP5|RPOB_CHLCH DNA-directed RNA polymerase subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoB PE=3 SV=1 901 1154 6.0E-36
sp|Q0ZJ28|RPOB_VITVI DNA-directed RNA polymerase subunit beta OS=Vitis vinifera GN=rpoB PE=3 SV=1 667 1094 6.0E-36
sp|Q2L8Z9|RPOB_GOSHI DNA-directed RNA polymerase subunit beta OS=Gossypium hirsutum GN=rpoB PE=3 SV=1 750 1094 6.0E-36
sp|Q1KXX2|RPOB_HELAN DNA-directed RNA polymerase subunit beta OS=Helianthus annuus GN=rpoB PE=3 SV=1 677 1094 7.0E-36
sp|A4GYQ0|RPOB_POPTR DNA-directed RNA polymerase subunit beta OS=Populus trichocarpa GN=rpoB PE=3 SV=1 750 1094 7.0E-36
sp|Q9XPS7|RPOB_WHEAT DNA-directed RNA polymerase subunit beta OS=Triticum aestivum GN=rpoB PE=3 SV=1 750 1094 8.0E-36
sp|A1E9Z8|RPOB_AGRST DNA-directed RNA polymerase subunit beta OS=Agrostis stolonifera GN=rpoB PE=3 SV=1 750 1094 8.0E-36
sp|A6MMT6|RPOB_ILLOL DNA-directed RNA polymerase subunit beta OS=Illicium oligandrum GN=rpoB PE=3 SV=2 667 1094 8.0E-36
sp|A0ZZ27|RPOB_GOSBA DNA-directed RNA polymerase subunit beta OS=Gossypium barbadense GN=rpoB PE=3 SV=1 750 1094 8.0E-36
sp|A4QL11|RPOB_DRANE DNA-directed RNA polymerase subunit beta OS=Draba nemorosa GN=rpoB PE=3 SV=1 750 1094 9.0E-36
sp|Q32RG0|RPOB_ZYGCR DNA-directed RNA polymerase subunit beta OS=Zygnema circumcarinatum GN=rpoB PE=3 SV=1 750 1094 9.0E-36
sp|A9LYH7|RPOB_ACOAM DNA-directed RNA polymerase subunit beta OS=Acorus americanus GN=rpoB PE=3 SV=1 750 1094 1.0E-35
sp|Q06GR8|RPOB_PIPCE DNA-directed RNA polymerase subunit beta OS=Piper cenocladum GN=rpoB PE=3 SV=1 655 1094 1.0E-35
sp|P30760|RPOB_MYCLE DNA-directed RNA polymerase subunit beta OS=Mycobacterium leprae (strain TN) GN=rpoB PE=3 SV=2 750 1151 1.0E-35
sp|B8ZSC7|RPOB_MYCLB DNA-directed RNA polymerase subunit beta OS=Mycobacterium leprae (strain Br4923) GN=rpoB PE=3 SV=1 750 1151 1.0E-35
sp|Q0G9X0|RPOB_DAUCA DNA-directed RNA polymerase subunit beta OS=Daucus carota GN=rpoB PE=3 SV=1 667 1094 1.0E-35
sp|A9BF33|RPOB_PETMO DNA-directed RNA polymerase subunit beta OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoB PE=3 SV=1 750 1151 1.0E-35
sp|P56869|RPOB_CHLMU DNA-directed RNA polymerase subunit beta OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpoB PE=3 SV=1 900 1151 1.0E-35
sp|A4QJJ1|RPOB_AETGR DNA-directed RNA polymerase subunit beta OS=Aethionema grandiflorum GN=rpoB PE=3 SV=1 750 1094 2.0E-35
sp|B0BBU6|RPOB_CHLTB DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpoB PE=3 SV=1 900 1151 2.0E-35
sp|B0B7N1|RPOB_CHLT2 DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpoB PE=3 SV=1 900 1151 2.0E-35
sp|P0CE09|RPOB_CHLTR DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpoB PE=3 SV=1 900 1151 2.0E-35
sp|Q3KM47|RPOB_CHLTA DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpoB PE=3 SV=1 900 1151 2.0E-35
sp|Q4VZP1|RPOB_CUCSA DNA-directed RNA polymerase subunit beta OS=Cucumis sativus GN=rpoB PE=3 SV=2 750 1094 2.0E-35
sp|A8Y9G0|RPOB_LOLPR DNA-directed RNA polymerase subunit beta OS=Lolium perenne GN=rpoB PE=3 SV=1 750 1094 2.0E-35
sp|A6MMB4|RPOB_CHLSC DNA-directed RNA polymerase subunit beta OS=Chloranthus spicatus GN=rpoB PE=3 SV=1 667 1094 2.0E-35
sp|Q8S8X9|RPOB_ATRBE DNA-directed RNA polymerase subunit beta OS=Atropa belladonna GN=rpoB PE=3 SV=1 652 1094 2.0E-35
sp|Q33C46|RPOB_NICTO DNA-directed RNA polymerase subunit beta OS=Nicotiana tomentosiformis GN=rpoB PE=3 SV=1 652 1094 3.0E-35
sp|A6MMJ9|RPOB_DIOEL DNA-directed RNA polymerase subunit beta OS=Dioscorea elephantipes GN=rpoB PE=3 SV=1 667 1094 3.0E-35
sp|A0A327|RPOB_COFAR DNA-directed RNA polymerase subunit beta OS=Coffea arabica GN=rpoB PE=3 SV=1 750 1094 3.0E-35
sp|A0PM24|RPOB_MYCUA DNA-directed RNA polymerase subunit beta OS=Mycobacterium ulcerans (strain Agy99) GN=rpoB PE=3 SV=1 750 1151 3.0E-35
sp|Q3B1H7|RPOB_CHLL7 DNA-directed RNA polymerase subunit beta OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpoB PE=3 SV=1 901 1154 3.0E-35
sp|P06271|RPOB_TOBAC DNA-directed RNA polymerase subunit beta OS=Nicotiana tabacum GN=rpoB PE=3 SV=1 652 1094 3.0E-35
sp|Q14FG5|RPOB_POPAL DNA-directed RNA polymerase subunit beta OS=Populus alba GN=rpoB PE=3 SV=1 750 1094 3.0E-35
sp|Q3C1G7|RPOB_NICSY DNA-directed RNA polymerase subunit beta OS=Nicotiana sylvestris GN=rpoB PE=3 SV=1 652 1094 3.0E-35
sp|Q49L06|RPOB_EUCGG DNA-directed RNA polymerase subunit beta OS=Eucalyptus globulus subsp. globulus GN=rpoB PE=3 SV=1 677 1094 3.0E-35
sp|Q85BW1|RPOB_ANTFO DNA-directed RNA polymerase subunit beta OS=Anthoceros formosae GN=rpoB PE=2 SV=1 750 1094 3.0E-35
sp|B2HSJ3|RPOB_MYCMM DNA-directed RNA polymerase subunit beta OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpoB PE=3 SV=1 750 1151 4.0E-35
sp|Q56P13|RPOB_LACSA DNA-directed RNA polymerase subunit beta OS=Lactuca sativa GN=rpoB PE=3 SV=2 667 1094 4.0E-35
sp|Q9L637|RPOB_AMYMS DNA-directed RNA polymerase subunit beta OS=Amycolatopsis mediterranei (strain S699) GN=rpoB PE=3 SV=2 754 1151 4.0E-35
sp|A4QJA7|RPOB_AETCO DNA-directed RNA polymerase subunit beta OS=Aethionema cordifolium GN=rpoB PE=3 SV=1 750 1094 4.0E-35
sp|B3E163|RPOB_METI4 DNA-directed RNA polymerase subunit beta OS=Methylacidiphilum infernorum (isolate V4) GN=rpoB PE=3 SV=1 900 1146 4.0E-35
sp|Q09G54|RPOB_PLAOC DNA-directed RNA polymerase subunit beta OS=Platanus occidentalis GN=rpoB PE=3 SV=1 677 1094 5.0E-35
sp|Q20EX1|RPOB_OLTVI DNA-directed RNA polymerase subunit beta OS=Oltmannsiellopsis viridis GN=rpoB PE=3 SV=1 750 1145 5.0E-35
sp|A1BD23|RPOB_CHLPD DNA-directed RNA polymerase subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoB PE=3 SV=1 901 1154 5.0E-35
sp|Q2MIJ5|RPOB_SOLBU DNA-directed RNA polymerase subunit beta OS=Solanum bulbocastanum GN=rpoB PE=3 SV=1 652 1094 5.0E-35
sp|A4GGA5|RPOB_PHAVU DNA-directed RNA polymerase subunit beta OS=Phaseolus vulgaris GN=rpoB PE=3 SV=1 652 1094 5.0E-35
sp|B1VES1|RPOB_CORU7 DNA-directed RNA polymerase subunit beta OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpoB PE=3 SV=1 750 1154 6.0E-35
sp|Q0P3M6|RPOB_OSTTA DNA-directed RNA polymerase subunit beta OS=Ostreococcus tauri GN=rpoB PE=3 SV=1 750 1094 6.0E-35
sp|Q6MDM1|RPOB_PARUW DNA-directed RNA polymerase subunit beta OS=Protochlamydia amoebophila (strain UWE25) GN=rpoB PE=3 SV=1 900 1094 6.0E-35
sp|B7ICR3|RPOB_THEAB DNA-directed RNA polymerase subunit beta OS=Thermosipho africanus (strain TCF52B) GN=rpoB PE=3 SV=1 750 1147 8.0E-35
sp|A4FPP3|RPOB_SACEN DNA-directed RNA polymerase subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoB PE=3 SV=1 750 1151 8.0E-35
sp|Q2MIA8|RPOB_SOLLC DNA-directed RNA polymerase subunit beta OS=Solanum lycopersicum GN=rpoB PE=3 SV=1 652 1094 9.0E-35
sp|Q9BBS9|RPOB_LOTJA DNA-directed RNA polymerase subunit beta OS=Lotus japonicus GN=rpoB PE=3 SV=1 750 1094 9.0E-35
sp|Q11QA5|RPOB_CYTH3 DNA-directed RNA polymerase subunit beta OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpoB PE=3 SV=1 901 1148 9.0E-35
sp|P11703|RPOB_SPIOL DNA-directed RNA polymerase subunit beta OS=Spinacia oleracea GN=rpoB PE=3 SV=1 750 1094 9.0E-35
sp|Q9MTM5|RPOB_OENEH DNA-directed RNA polymerase subunit beta OS=Oenothera elata subsp. hookeri GN=rpoB PE=3 SV=2 677 1094 9.0E-35
sp|Q9Z9A0|RPOB_CHLPN DNA-directed RNA polymerase subunit beta OS=Chlamydia pneumoniae GN=rpoB PE=3 SV=1 900 1151 1.0E-34
sp|Q1BDF0|RPOB_MYCSS DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain MCS) GN=rpoB PE=3 SV=2 750 1151 1.0E-34
sp|A1UBJ3|RPOB_MYCSK DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain KMS) GN=rpoB PE=3 SV=1 750 1151 1.0E-34
sp|Q2VEI4|RPOB_SOLTU DNA-directed RNA polymerase subunit beta OS=Solanum tuberosum GN=rpoB PE=3 SV=1 652 1094 1.0E-34
sp|A5U052|RPOB_MYCTA DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpoB PE=3 SV=2 750 1151 1.0E-34
sp|P9WGY9|RPOB_MYCTU DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpoB PE=1 SV=1 750 1151 1.0E-34
sp|P9WGY8|RPOB_MYCTO DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoB PE=3 SV=1 750 1151 1.0E-34
sp|A1KGE7|RPOB_MYCBP DNA-directed RNA polymerase subunit beta OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoB PE=3 SV=2 750 1151 1.0E-34
sp|P0A681|RPOB_MYCBO DNA-directed RNA polymerase subunit beta OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpoB PE=3 SV=1 750 1151 1.0E-34
sp|A3PV78|RPOB_MYCSJ DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain JLS) GN=rpoB PE=3 SV=1 750 1151 2.0E-34
sp|Q0RRT0|RPOB_FRAAA DNA-directed RNA polymerase subunit beta OS=Frankia alni (strain ACN14a) GN=rpoB PE=3 SV=1 750 1151 2.0E-34
sp|A1T4J2|RPOB_MYCVP DNA-directed RNA polymerase subunit beta OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoB PE=3 SV=2 750 1151 2.0E-34
sp|Q68S14|RPOB_PANGI DNA-directed RNA polymerase subunit beta OS=Panax ginseng GN=rpoB PE=3 SV=1 667 1094 2.0E-34
sp|Q8HVY5|RPOB_SOYBN DNA-directed RNA polymerase subunit beta OS=Glycine max GN=rpoB PE=3 SV=2 652 1094 2.0E-34
sp|Q09FW9|RPOB_NANDO DNA-directed RNA polymerase subunit beta OS=Nandina domestica GN=rpoB PE=3 SV=1 750 1094 2.0E-34
sp|A0M3Y9|RPOB_GRAFK DNA-directed RNA polymerase subunit beta OS=Gramella forsetii (strain KT0803) GN=rpoB PE=3 SV=1 901 1094 2.0E-34
sp|Q5YPE0|RPOB2_NOCFA DNA-directed RNA polymerase subunit beta 2 OS=Nocardia farcinica (strain IFM 10152) GN=rpoB2 PE=3 SV=1 750 1151 2.0E-34
sp|Q0SFB3|RPOB_RHOJR DNA-directed RNA polymerase subunit beta OS=Rhodococcus jostii (strain RHA1) GN=rpoB PE=3 SV=1 750 1151 2.0E-34
sp|A8Z5T3|RPOB_SULMW DNA-directed RNA polymerase subunit beta OS=Sulcia muelleri (strain GWSS) GN=rpoB PE=3 SV=1 899 1094 2.0E-34
sp|A8SE86|RPOB_CERDE DNA-directed RNA polymerase subunit beta OS=Ceratophyllum demersum GN=rpoB PE=3 SV=1 667 1094 2.0E-34
sp|C1AYV9|RPOB_RHOOB DNA-directed RNA polymerase subunit beta OS=Rhodococcus opacus (strain B4) GN=rpoB PE=3 SV=1 750 1151 3.0E-34
sp|P60281|RPOB_MYCS2 DNA-directed RNA polymerase subunit beta OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpoB PE=1 SV=1 750 1151 3.0E-34
sp|Q8NT26|RPOB_CORGL DNA-directed RNA polymerase subunit beta OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpoB PE=3 SV=1 750 1154 3.0E-34
sp|C4LL71|RPOB_CORK4 DNA-directed RNA polymerase subunit beta OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpoB PE=3 SV=1 750 1154 3.0E-34
sp|A4QBG2|RPOB_CORGB DNA-directed RNA polymerase subunit beta OS=Corynebacterium glutamicum (strain R) GN=rpoB PE=3 SV=1 750 1154 3.0E-34
sp|A8W3B6|RPOB_CUSEX DNA-directed RNA polymerase subunit beta OS=Cuscuta exaltata GN=rpoB PE=3 SV=1 485 1094 4.0E-34
sp|A9WSY0|RPOB_RENSM DNA-directed RNA polymerase subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rpoB PE=3 SV=1 750 1147 4.0E-34
sp|Q7YJX8|RPOB_CALFG DNA-directed RNA polymerase subunit beta OS=Calycanthus floridus var. glaucus GN=rpoB PE=3 SV=1 667 1094 4.0E-34
sp|Q4JT32|RPOB_CORJK DNA-directed RNA polymerase subunit beta OS=Corynebacterium jeikeium (strain K411) GN=rpoB PE=3 SV=1 750 1154 4.0E-34
sp|C5CGD9|RPOB_KOSOT DNA-directed RNA polymerase subunit beta OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpoB PE=3 SV=1 750 1147 5.0E-34
sp|Q6A6K6|RPOB_PROAC DNA-directed RNA polymerase subunit beta OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpoB PE=3 SV=1 750 1147 5.0E-34
sp|A6YGE0|RPOB2_LEPTE DNA-directed RNA polymerase subunit beta C-terminal section OS=Leptosira terrestris GN=rpoB2 PE=3 SV=1 826 1153 5.0E-34
sp|Q0G9M7|RPOB_LIRTU DNA-directed RNA polymerase subunit beta OS=Liriodendron tulipifera GN=rpoB PE=3 SV=2 667 1094 5.0E-34
sp|C0ZVQ6|RPOB_RHOE4 DNA-directed RNA polymerase subunit beta OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpoB PE=3 SV=1 750 1151 6.0E-34
sp|A6H5F9|RPOB_CYCTA DNA-directed RNA polymerase subunit beta OS=Cycas taitungensis GN=rpoB PE=3 SV=1 750 1094 7.0E-34
sp|A6LE81|RPOB_PARD8 DNA-directed RNA polymerase subunit beta OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpoB PE=3 SV=1 901 1094 7.0E-34
sp|A0LRL3|RPOB_ACIC1 DNA-directed RNA polymerase subunit beta OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoB PE=3 SV=1 750 1151 7.0E-34
sp|Q8KG15|RPOB_CHLTE DNA-directed RNA polymerase subunit beta OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpoB PE=3 SV=1 901 1154 7.0E-34
sp|Q5YQP4|RPOB1_NOCFA DNA-directed RNA polymerase subunit beta 1 OS=Nocardia farcinica (strain IFM 10152) GN=rpoB1 PE=3 SV=1 754 1147 7.0E-34
sp|P60283|RPOB_PHYPA DNA-directed RNA polymerase subunit beta OS=Physcomitrella patens subsp. patens GN=rpoB PE=3 SV=1 667 1094 7.0E-34
sp|Q5L5I3|RPOB_CHLAB DNA-directed RNA polymerase subunit beta OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpoB PE=3 SV=1 900 1151 8.0E-34
sp|A7Y3B9|RPOB_IPOPU DNA-directed RNA polymerase subunit beta OS=Ipomoea purpurea GN=rpoB PE=3 SV=1 667 1094 8.0E-34
sp|Q822J1|RPOB_CHLCV DNA-directed RNA polymerase subunit beta OS=Chlamydophila caviae (strain GPIC) GN=rpoB PE=3 SV=1 900 1151 8.0E-34
sp|Q255E6|RPOB_CHLFF DNA-directed RNA polymerase subunit beta OS=Chlamydophila felis (strain Fe/C-56) GN=rpoB PE=3 SV=1 900 1151 9.0E-34
sp|Q7MX27|RPOB_PORGI DNA-directed RNA polymerase subunit beta OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoB PE=3 SV=1 901 1094 1.0E-33
sp|B2RL45|RPOB_PORG3 DNA-directed RNA polymerase subunit beta OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoB PE=3 SV=1 901 1094 1.0E-33
sp|Q06FW9|RPOB_PELHO DNA-directed RNA polymerase subunit beta OS=Pelargonium hortorum GN=rpoB PE=3 SV=1 750 1094 1.0E-33
sp|A8F4G0|RPOB_PSELT DNA-directed RNA polymerase subunit beta OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoB PE=3 SV=1 750 1151 1.0E-33
sp|Q8MA12|RPOB_CHAGL DNA-directed RNA polymerase subunit beta OS=Chaetosphaeridium globosum GN=rpoB PE=3 SV=1 750 1094 1.0E-33
sp|Q589C0|RPOB_SILLA DNA-directed RNA polymerase subunit beta OS=Silene latifolia GN=rpoB PE=3 SV=1 750 1094 2.0E-33
sp|Q9F3X8|RPOB_PORCN DNA-directed RNA polymerase subunit beta OS=Porphyromonas cangingivalis GN=rpoB PE=3 SV=1 899 1094 2.0E-33
sp|B0RB25|RPOB_CLAMS DNA-directed RNA polymerase subunit beta OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpoB PE=3 SV=1 750 1147 2.0E-33
sp|A5CUC7|RPOB_CLAM3 DNA-directed RNA polymerase subunit beta OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpoB PE=3 SV=1 750 1147 2.0E-33
sp|P60280|RPOB_CORDI DNA-directed RNA polymerase subunit beta OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rpoB PE=3 SV=1 670 1154 2.0E-33
sp|Q06H05|RPOB_DRIGR DNA-directed RNA polymerase subunit beta OS=Drimys granadensis GN=rpoB PE=3 SV=1 750 1094 3.0E-33
sp|Q7URW6|RPOB_RHOBA DNA-directed RNA polymerase subunit beta OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpoB PE=3 SV=2 899 1097 3.0E-33
sp|Q47LI5|RPOB_THEFY DNA-directed RNA polymerase subunit beta OS=Thermobifida fusca (strain YX) GN=rpoB PE=3 SV=1 750 1151 3.0E-33
sp|A6GYU0|RPOB_FLAPJ DNA-directed RNA polymerase subunit beta OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpoB PE=3 SV=1 901 1148 5.0E-33
sp|Q64NJ7|RPOB_BACFR DNA-directed RNA polymerase subunit beta OS=Bacteroides fragilis (strain YCH46) GN=rpoB PE=3 SV=1 901 1094 6.0E-33
sp|Q5L897|RPOB_BACFN DNA-directed RNA polymerase subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpoB PE=3 SV=1 901 1094 6.0E-33
sp|A5FIJ3|RPOB_FLAJ1 DNA-directed RNA polymerase subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpoB PE=3 SV=1 901 1148 6.0E-33
sp|A0JZ93|RPOB_ARTS2 DNA-directed RNA polymerase subunit beta OS=Arthrobacter sp. (strain FB24) GN=rpoB PE=3 SV=1 750 1147 6.0E-33
sp|A4T1P4|RPOB_MYCGI DNA-directed RNA polymerase subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoB PE=3 SV=1 750 1151 8.0E-33
sp|A6BM50|RPOB_GNEPA DNA-directed RNA polymerase subunit beta OS=Gnetum parvifolium GN=rpoB PE=3 SV=1 754 1094 9.0E-33
sp|A1A317|RPOB_BIFAA DNA-directed RNA polymerase subunit beta OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpoB PE=3 SV=2 665 1147 9.0E-33
sp|Q8A469|RPOB_BACTN DNA-directed RNA polymerase subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoB PE=3 SV=1 901 1094 1.0E-32
sp|A1R8V4|RPOB_ARTAT DNA-directed RNA polymerase subunit beta OS=Arthrobacter aurescens (strain TC1) GN=rpoB PE=3 SV=1 750 1147 1.0E-32
sp|A6KYK3|RPOB_BACV8 DNA-directed RNA polymerase subunit beta OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoB PE=3 SV=1 901 1094 1.0E-32
sp|Q06RD9|RPOB_JASNU DNA-directed RNA polymerase subunit beta OS=Jasminum nudiflorum GN=rpoB PE=3 SV=1 750 1094 1.0E-32
sp|Q7YN57|RPOB_EIMTE DNA-directed RNA polymerase subunit beta OS=Eimeria tenella GN=rpoB PE=3 SV=1 746 1145 2.0E-32
sp|A7HNY2|RPOB_FERNB DNA-directed RNA polymerase subunit beta OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpoB PE=3 SV=1 750 1147 2.0E-32
sp|B3DTE2|RPOB_BIFLD DNA-directed RNA polymerase subunit beta OS=Bifidobacterium longum (strain DJO10A) GN=rpoB PE=3 SV=1 665 1152 3.0E-32
sp|Q8G514|RPOB_BIFLO DNA-directed RNA polymerase subunit beta OS=Bifidobacterium longum (strain NCC 2705) GN=rpoB PE=3 SV=1 665 1152 3.0E-32
sp|C6C179|RPOB_DESAD DNA-directed RNA polymerase subunit beta OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpoB PE=3 SV=1 899 1152 3.0E-32
sp|B7GUG7|RPOB_BIFLS DNA-directed RNA polymerase subunit beta OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpoB PE=3 SV=1 665 1152 4.0E-32
sp|Q6ACX5|RPOB_LEIXX DNA-directed RNA polymerase subunit beta OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpoB PE=3 SV=1 750 1147 5.0E-32
sp|A7M958|RPOB_CUSRE DNA-directed RNA polymerase subunit beta OS=Cuscuta reflexa GN=rpoB PE=2 SV=2 750 1094 5.0E-32
sp|A5IJW3|RPOB_THEP1 DNA-directed RNA polymerase subunit beta OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpoB PE=3 SV=1 750 1151 6.0E-32
sp|B1L935|RPOB_THESQ DNA-directed RNA polymerase subunit beta OS=Thermotoga sp. (strain RQ2) GN=rpoB PE=3 SV=1 750 1151 6.0E-32
sp|P06272|RPOB_MARPO DNA-directed RNA polymerase subunit beta OS=Marchantia polymorpha GN=rpoB PE=3 SV=1 750 1094 6.0E-32
sp|Q3ZJ93|RPOB_PSEAK DNA-directed RNA polymerase subunit beta OS=Pseudendoclonium akinetum GN=rpoB PE=3 SV=1 822 1145 6.0E-32
sp|Q01VB1|RPOB_SOLUE DNA-directed RNA polymerase subunit beta OS=Solibacter usitatus (strain Ellin6076) GN=rpoB PE=3 SV=2 899 1147 7.0E-32
sp|P29398|RPOB_THEMA DNA-directed RNA polymerase subunit beta OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpoB PE=3 SV=2 750 1151 7.0E-32
sp|P23579|RPOB_EUGGR DNA-directed RNA polymerase subunit beta OS=Euglena gracilis GN=rpoB PE=3 SV=1 365 1147 7.0E-32
sp|Q8WI24|RPOB_PSINU DNA-directed RNA polymerase subunit beta OS=Psilotum nudum GN=rpoB PE=3 SV=1 750 1094 2.0E-31
sp|A2T324|RPOB_ANGEV DNA-directed RNA polymerase subunit beta OS=Angiopteris evecta GN=rpoB PE=3 SV=1 563 1143 3.0E-31
sp|A1AX75|RPOB_RUTMC DNA-directed RNA polymerase subunit beta OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpoB PE=3 SV=1 899 1148 4.0E-31
sp|O54888|RPA2_RAT DNA-directed RNA polymerase I subunit RPA2 OS=Rattus norvegicus GN=Polr1b PE=1 SV=1 19 522 7.0E-30
sp|Q2RFN9|RPOB_MOOTA DNA-directed RNA polymerase subunit beta OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoB PE=3 SV=1 32 529 1.0E-13
sp|Q3A9Q7|RPOB_CARHZ DNA-directed RNA polymerase subunit beta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoB PE=3 SV=1 32 529 4.0E-11
sp|Q250P0|RPOB_DESHY DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain Y51) GN=rpoB PE=3 SV=2 39 518 1.0E-10
sp|B8G1V8|RPOB_DESHD DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpoB PE=3 SV=1 39 518 1.0E-10
sp|B1HMZ6|RPOB_LYSSC DNA-directed RNA polymerase subunit beta OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoB PE=3 SV=1 32 267 9.0E-10
sp|Q18CF1|RPOB_PEPD6 DNA-directed RNA polymerase subunit beta OS=Peptoclostridium difficile (strain 630) GN=rpoB PE=3 SV=1 32 293 4.0E-09
sp|Q8CQ84|RPOB_STAES DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoB PE=3 SV=1 28 303 5.0E-09
sp|Q5HRL0|RPOB_STAEQ DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoB PE=3 SV=1 28 303 5.0E-09
sp|Q4L3K3|RPOB_STAHJ DNA-directed RNA polymerase subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoB PE=3 SV=1 28 303 5.0E-09
sp|Q5L405|RPOB_GEOKA DNA-directed RNA polymerase subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=rpoB PE=3 SV=1 39 303 5.0E-09
sp|A9B6J3|RPOB_HERA2 DNA-directed RNA polymerase subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoB PE=3 SV=1 32 529 7.0E-09
sp|Q932F8|RPOB_STAAM DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|P60279|RPOB_STAAW DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MW2) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|A8YZP0|RPOB_STAAT DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|Q6GBU5|RPOB_STAAS DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|P60278|RPOB_STAAN DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain N315) GN=rpoB PE=1 SV=1 28 303 1.0E-08
sp|A6QEJ4|RPOB_STAAE DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Newman) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|Q2YSB9|RPOB_STAAB DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|P47768|RPOB_STAA8 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoB PE=3 SV=2 28 303 1.0E-08
sp|Q2FJ98|RPOB_STAA3 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300) GN=rpoB PE=3 SV=2 28 303 1.0E-08
sp|A6TZ19|RPOB_STAA2 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH1) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|A7WYW7|RPOB_STAA1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|A5IQ96|RPOB_STAA9 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH9) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|Q6GJC6|RPOB_STAAR DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|Q5HID3|RPOB_STAAC DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain COL) GN=rpoB PE=3 SV=1 28 303 1.0E-08
sp|B9E8Q5|RPOB_MACCJ DNA-directed RNA polymerase subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpoB PE=3 SV=1 28 267 2.0E-08
sp|A4IJI1|RPOB_GEOTN DNA-directed RNA polymerase subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoB PE=3 SV=1 39 303 3.0E-08
sp|A8F4G0|RPOB_PSELT DNA-directed RNA polymerase subunit beta OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoB PE=3 SV=1 335 518 7.0E-08
sp|B0K5G8|RPOB_THEPX DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter sp. (strain X514) GN=rpoB PE=3 SV=1 32 264 9.0E-08
sp|B0KCJ2|RPOB_THEP3 DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoB PE=3 SV=1 32 264 1.0E-07
sp|Q9Z9M2|RPOB_BACHD DNA-directed RNA polymerase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoB PE=3 SV=1 39 303 3.0E-07
sp|B9DKV0|RPOB_STACT DNA-directed RNA polymerase subunit beta OS=Staphylococcus carnosus (strain TM300) GN=rpoB PE=3 SV=1 28 303 7.0E-07
sp|P37870|RPOB_BACSU DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) GN=rpoB PE=1 SV=2 32 277 7.0E-07
sp|C0ZIH0|RPOB_BREBN DNA-directed RNA polymerase subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpoB PE=3 SV=1 39 303 8.0E-07
sp|Q65PB5|RPOB_BACLD DNA-directed RNA polymerase subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoB PE=3 SV=1 32 277 9.0E-07
sp|A8F976|RPOB_BACP2 DNA-directed RNA polymerase subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=rpoB PE=3 SV=1 39 303 1.0E-06
sp|A7Z0M9|RPOB_BACMF DNA-directed RNA polymerase subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoB PE=3 SV=1 32 277 1.0E-06
sp|Q1AU22|RPOB_RUBXD DNA-directed RNA polymerase subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpoB PE=3 SV=1 12 276 1.0E-06
sp|A5IJW3|RPOB_THEP1 DNA-directed RNA polymerase subunit beta OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpoB PE=3 SV=1 365 518 1.0E-06
sp|A3DIZ4|RPOB_CLOTH DNA-directed RNA polymerase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoB PE=3 SV=1 44 269 2.0E-06
sp|A5N4N9|RPOB_CLOK5 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoB PE=3 SV=1 32 271 2.0E-06
sp|B9DYA1|RPOB_CLOK1 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain NBRC 12016) GN=rpoB PE=3 SV=1 32 271 2.0E-06
sp|Q97EG9|RPOB_CLOAB DNA-directed RNA polymerase subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoB PE=3 SV=1 11 260 2.0E-06
sp|Q67JT3|RPOB_SYMTH DNA-directed RNA polymerase subunit beta OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoB PE=3 SV=1 32 267 3.0E-06
sp|Q9RLT9|RPOB_LISMO DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoB PE=3 SV=1 32 267 6.0E-06
sp|Q724F0|RPOB_LISMF DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoB PE=3 SV=1 32 267 6.0E-06
sp|C1KYJ3|RPOB_LISMC DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpoB PE=3 SV=1 32 267 6.0E-06
sp|A0AF63|RPOB_LISW6 DNA-directed RNA polymerase subunit beta OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoB PE=3 SV=1 32 267 6.0E-06
sp|B8DEY8|RPOB_LISMH DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpoB PE=3 SV=1 32 267 6.0E-06
sp|Q92F22|RPOB_LISIN DNA-directed RNA polymerase subunit beta OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoB PE=3 SV=1 32 267 6.0E-06
sp|Q8ETY8|RPOB_OCEIH DNA-directed RNA polymerase subunit beta OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoB PE=3 SV=1 39 303 7.0E-06
sp|Q5WLS0|RPOB_BACSK DNA-directed RNA polymerase subunit beta OS=Bacillus clausii (strain KSM-K16) GN=rpoB PE=3 SV=1 39 303 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0090304 nucleic acid metabolic process No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1289 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6484
Ophiocordyceps camponoti-floridani Ophcf2|06594
Ophiocordyceps camponoti-rufipedis Ophun1|4660
Ophiocordyceps kimflemingae Ophio5|6437
Ophiocordyceps subramaniannii Hirsu2|9129

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1289
MPPIDDGFEALLEPFYNGKKLTDPVSTKEDKFQLLPAFLKVKGLVKQHIDSYNFFVEHEIKEIVRANRTIRSDVD
SNFWLEFTDIRVDQPRRQDHNEAKSRSDVTPMECRLRDMTYAAPILVNIAYIRDRQKIVRKNVPLGRMPVMLKSC
KCRLSGANNAQMEAMNECPLDPGGYFIVNGTEKVILIQEQLSKNRVIVEADEKNNIISASVTSSTHERKSKTYVT
LKKDKILLTHNVLVEGVPIVIVLKALGGLSDFEIMQLVAGSDGRYQDEFLINFDEAIKAGIFTQHQALEYIGSRV
KMGSRRSQFGSQARRNNVEEGLDALANLVIAHVPIEGLDFYPKAIYVAMMTRRVLMASQDSKLVDDRDFVGNKRL
ELAGQLLSLIFEDLFKRFMVEVKMSIDKFLKKNNRAVPLDAVHMISNHANSIGLGINRAIQTGNWSVKRFNMNRA
GITHVLSRLSYISALGMMTRISSQFEKTRKVSGPRALQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTNIDET
PIKRWIFTLDTGVEPIRNFSGAEMHRQGSYTIHVNGTPFALTRYPKRFASRFRTMRRRGWISPFVSININSHFNA
VHIATDEGRICRPYIIVKHGRQKLKAEHLKLLQLGKVTFDDFLTNGIVEYLDVNEENDALVTIYEEAITQSTTHL
EIEPFTILGAVAGLIPFPHHNQSPRNTYQCAMGKQAIGAIAYNQFNRIDTLLYTLVYPQRPMVITKTIELIHYDK
LPAGQNATVIVMSFSGYDIEDALVLNKASIDRGFGRCQVFRKYTSELQKYPNGRRERIGDPANEMSGGIKRRVEK
YGALDDDGLATVGYRVKNGDVMVKKETPLDLTTTGIGIDRGPSEYRDSSVEYRIPDPAYIDKVMISQTEKDTTVI
KVQTRQTRRPELGDKFSSRHGQKGVVGIIVDQEDMPFSDSGLTPDIIMNPHGFPSRMTVGKLLECLTGKAAVLDG
RKDYGFGDAFRSHPVEEMGQVLLRHGFSWEGKDYFTSGMTGEPLEAYIFNGPIYYQRLKHMVQDKMHSRARGPRA
ILTRQPTEGRSRSGGLRLGEMERDCLIAYGASQLLLERLMLSSDATEIDICQQCGLFGYRGYCHTCKSTRGVTRM
TMPYAAKLLVQELISMNVGVRLQLEDEFPHAK*
Coding >OphauG2|1289
ATGCCTCCCATCGACGACGGCTTCGAAGCTCTCCTCGAGCCATTTTACAACGGCAAGAAGCTCACAGATCCCGTG
TCGACAAAGGAAGACAAATTCCAATTATTACCAGCTTTTCTCAAAGTCAAGGGTCTGGTAAAACAGCACATAGAC
TCGTACAACTTCTTTGTAGAGCACGAAATCAAAGAAATCGTGCGAGCCAATCGCACCATACGCAGCGATGTGGAC
AGCAACTTCTGGCTCGAATTCACCGATATACGCGTCGATCAGCCGCGTCGACAAGATCATAACGAAGCCAAGTCA
CGCAGCGATGTCACTCCCATGGAGTGCCGTCTGCGCGACATGACATATGCTGCTCCGATACTAGTCAATATAGCC
TATATTCGTGATCGTCAAAAGATTGTTCGCAAAAATGTGCCGCTTGGGCGGATGCCAGTTATGCTCAAAAGCTGC
AAGTGCCGACTCAGTGGAGCCAATAATGCGCAGATGGAGGCCATGAACGAATGCCCCCTCGACCCCGGTGGCTAT
TTCATTGTCAATGGAACGGAAAAGGTAATTCTGATCCAAGAGCAATTAAGTAAGAACCGTGTCATTGTCGAAGCC
GACGAGAAAAACAACATCATCTCAGCATCCGTTACCAGCTCAACCCATGAACGCAAATCCAAAACGTACGTGACG
TTGAAAAAGGACAAAATTCTACTTACGCACAACGTTTTGGTCGAGGGAGTCCCCATTGTCATTGTTCTCAAGGCT
CTAGGAGGCCTCTCGGATTTCGAAATTATGCAGCTCGTGGCGGGCTCGGACGGCAGATATCAGGACGAATTTCTC
ATCAATTTCGACGAGGCTATCAAGGCTGGCATCTTTACCCAGCACCAAGCCCTTGAGTACATTGGCAGCAGGGTA
AAGATGGGGTCACGGAGATCCCAGTTCGGATCACAGGCGCGTCGAAATAACGTCGAAGAAGGATTAGACGCATTG
GCCAATCTTGTCATTGCCCATGTACCCATTGAAGGTCTTGATTTCTATCCCAAGGCCATCTACGTTGCCATGATG
ACTCGGCGCGTCCTCATGGCCTCGCAGGATTCAAAGCTTGTTGATGACAGAGACTTTGTGGGCAACAAGCGGCTG
GAACTTGCAGGCCAACTGCTCTCTCTAATCTTTGAAGATCTGTTTAAACGATTCATGGTCGAGGTCAAAATGTCG
ATTGACAAGTTTCTCAAGAAGAACAACCGAGCCGTGCCGCTGGACGCTGTTCATATGATTAGCAATCACGCGAAC
AGCATTGGTCTGGGGATAAATCGTGCCATTCAGACGGGCAACTGGAGCGTCAAGCGCTTCAACATGAACCGAGCA
GGTATAACCCACGTGCTAAGTCGTTTAAGCTACATTAGCGCTCTGGGCATGATGACTCGAATCAGCAGCCAATTT
GAAAAGACGCGCAAAGTATCAGGCCCCCGTGCGCTGCAGCCGTCGCAATGGGGCATGCTGTGTCCTTCGGATACA
CCAGAAGGCGAGGCTTGCGGTCTCGTCAAGAATTTGGCTCTTATGACGCATATTACAACCAACATTGATGAGACG
CCAATCAAGAGATGGATATTCACCCTTGACACTGGGGTTGAGCCTATTCGGAACTTTTCGGGGGCAGAGATGCAT
CGCCAGGGCTCATACACGATTCATGTCAACGGGACGCCTTTTGCTCTGACGAGATACCCCAAACGATTTGCGTCG
CGGTTCCGGACGATGCGCCGTCGAGGCTGGATATCCCCTTTTGTCAGCATCAACATCAATTCACACTTTAACGCG
GTACACATTGCGACTGATGAGGGCCGCATTTGCCGGCCCTACATCATTGTCAAGCACGGCAGACAGAAGCTCAAG
GCAGAACATCTCAAGCTTCTGCAGCTTGGCAAAGTCACGTTTGACGATTTTTTGACCAATGGCATCGTCGAGTAT
CTCGACGTCAACGAGGAAAACGATGCGCTCGTAACTATATACGAGGAGGCCATCACACAGAGCACTACTCACCTG
GAAATCGAGCCCTTTACTATTCTCGGGGCTGTCGCGGGATTAATTCCTTTTCCACACCATAACCAGTCTCCTCGA
AATACCTACCAGTGCGCCATGGGCAAGCAAGCAATTGGAGCCATTGCATACAACCAATTTAACCGCATCGACACG
CTCTTGTACACATTGGTTTATCCGCAGAGGCCCATGGTAATTACCAAGACGATTGAGCTGATTCACTACGACAAG
CTGCCCGCTGGTCAGAATGCCACTGTTATTGTCATGTCGTTTTCGGGTTACGACATTGAAGATGCGCTTGTGCTA
AACAAGGCATCCATTGACCGGGGCTTTGGGCGCTGCCAAGTCTTCCGCAAGTACACGAGTGAGCTTCAAAAGTAC
CCCAACGGCAGGAGAGAGCGGATTGGAGATCCTGCCAATGAAATGTCTGGAGGTATCAAGCGACGTGTCGAAAAA
TACGGGGCCTTGGATGATGATGGCCTGGCCACAGTGGGGTACAGAGTCAAGAATGGCGACGTCATGGTCAAAAAG
GAGACGCCGCTGGACTTGACAACAACGGGAATAGGCATCGATCGTGGACCAAGCGAGTATCGAGATTCCTCAGTA
GAATATCGCATTCCCGACCCAGCCTATATCGACAAGGTGATGATTTCCCAGACAGAAAAGGACACAACTGTCATC
AAGGTGCAGACGAGGCAGACACGAAGGCCTGAGCTTGGGGACAAGTTTTCGTCTCGGCACGGACAAAAAGGAGTT
GTGGGAATAATTGTTGATCAAGAGGACATGCCCTTTTCGGATAGCGGGCTGACTCCCGATATTATCATGAATCCT
CACGGATTTCCATCACGAATGACAGTCGGCAAACTGCTTGAATGCTTGACAGGAAAGGCGGCCGTTCTGGATGGC
CGCAAAGACTATGGCTTTGGAGATGCCTTTCGGTCGCATCCGGTAGAGGAGATGGGCCAAGTTTTGCTCCGACAT
GGGTTCTCGTGGGAGGGCAAAGACTACTTTACGTCTGGAATGACAGGCGAACCGCTTGAGGCTTACATCTTTAAC
GGCCCAATCTACTACCAGCGGCTTAAGCACATGGTCCAAGACAAGATGCATTCTCGAGCGCGCGGTCCTCGCGCC
ATTCTTACTCGGCAGCCAACCGAAGGTCGTTCACGGTCTGGCGGCCTGAGACTGGGAGAAATGGAGCGCGATTGC
TTGATTGCATACGGAGCGTCGCAACTATTACTGGAGCGACTGATGCTCAGCTCGGACGCAACGGAAATTGACATT
TGCCAGCAATGTGGTCTTTTTGGATACCGTGGATATTGCCATACATGCAAGAGCACTAGAGGGGTGACGAGGATG
ACGATGCCATACGCAGCCAAGCTGCTGGTCCAAGAGCTGATTAGCATGAATGTCGGGGTGCGTCTTCAACTTGAG
GACGAGTTTCCTCATGCAAAATGA
Transcript >OphauG2|1289
ATGCCTCCCATCGACGACGGCTTCGAAGCTCTCCTCGAGCCATTTTACAACGGCAAGAAGCTCACAGATCCCGTG
TCGACAAAGGAAGACAAATTCCAATTATTACCAGCTTTTCTCAAAGTCAAGGGTCTGGTAAAACAGCACATAGAC
TCGTACAACTTCTTTGTAGAGCACGAAATCAAAGAAATCGTGCGAGCCAATCGCACCATACGCAGCGATGTGGAC
AGCAACTTCTGGCTCGAATTCACCGATATACGCGTCGATCAGCCGCGTCGACAAGATCATAACGAAGCCAAGTCA
CGCAGCGATGTCACTCCCATGGAGTGCCGTCTGCGCGACATGACATATGCTGCTCCGATACTAGTCAATATAGCC
TATATTCGTGATCGTCAAAAGATTGTTCGCAAAAATGTGCCGCTTGGGCGGATGCCAGTTATGCTCAAAAGCTGC
AAGTGCCGACTCAGTGGAGCCAATAATGCGCAGATGGAGGCCATGAACGAATGCCCCCTCGACCCCGGTGGCTAT
TTCATTGTCAATGGAACGGAAAAGGTAATTCTGATCCAAGAGCAATTAAGTAAGAACCGTGTCATTGTCGAAGCC
GACGAGAAAAACAACATCATCTCAGCATCCGTTACCAGCTCAACCCATGAACGCAAATCCAAAACGTACGTGACG
TTGAAAAAGGACAAAATTCTACTTACGCACAACGTTTTGGTCGAGGGAGTCCCCATTGTCATTGTTCTCAAGGCT
CTAGGAGGCCTCTCGGATTTCGAAATTATGCAGCTCGTGGCGGGCTCGGACGGCAGATATCAGGACGAATTTCTC
ATCAATTTCGACGAGGCTATCAAGGCTGGCATCTTTACCCAGCACCAAGCCCTTGAGTACATTGGCAGCAGGGTA
AAGATGGGGTCACGGAGATCCCAGTTCGGATCACAGGCGCGTCGAAATAACGTCGAAGAAGGATTAGACGCATTG
GCCAATCTTGTCATTGCCCATGTACCCATTGAAGGTCTTGATTTCTATCCCAAGGCCATCTACGTTGCCATGATG
ACTCGGCGCGTCCTCATGGCCTCGCAGGATTCAAAGCTTGTTGATGACAGAGACTTTGTGGGCAACAAGCGGCTG
GAACTTGCAGGCCAACTGCTCTCTCTAATCTTTGAAGATCTGTTTAAACGATTCATGGTCGAGGTCAAAATGTCG
ATTGACAAGTTTCTCAAGAAGAACAACCGAGCCGTGCCGCTGGACGCTGTTCATATGATTAGCAATCACGCGAAC
AGCATTGGTCTGGGGATAAATCGTGCCATTCAGACGGGCAACTGGAGCGTCAAGCGCTTCAACATGAACCGAGCA
GGTATAACCCACGTGCTAAGTCGTTTAAGCTACATTAGCGCTCTGGGCATGATGACTCGAATCAGCAGCCAATTT
GAAAAGACGCGCAAAGTATCAGGCCCCCGTGCGCTGCAGCCGTCGCAATGGGGCATGCTGTGTCCTTCGGATACA
CCAGAAGGCGAGGCTTGCGGTCTCGTCAAGAATTTGGCTCTTATGACGCATATTACAACCAACATTGATGAGACG
CCAATCAAGAGATGGATATTCACCCTTGACACTGGGGTTGAGCCTATTCGGAACTTTTCGGGGGCAGAGATGCAT
CGCCAGGGCTCATACACGATTCATGTCAACGGGACGCCTTTTGCTCTGACGAGATACCCCAAACGATTTGCGTCG
CGGTTCCGGACGATGCGCCGTCGAGGCTGGATATCCCCTTTTGTCAGCATCAACATCAATTCACACTTTAACGCG
GTACACATTGCGACTGATGAGGGCCGCATTTGCCGGCCCTACATCATTGTCAAGCACGGCAGACAGAAGCTCAAG
GCAGAACATCTCAAGCTTCTGCAGCTTGGCAAAGTCACGTTTGACGATTTTTTGACCAATGGCATCGTCGAGTAT
CTCGACGTCAACGAGGAAAACGATGCGCTCGTAACTATATACGAGGAGGCCATCACACAGAGCACTACTCACCTG
GAAATCGAGCCCTTTACTATTCTCGGGGCTGTCGCGGGATTAATTCCTTTTCCACACCATAACCAGTCTCCTCGA
AATACCTACCAGTGCGCCATGGGCAAGCAAGCAATTGGAGCCATTGCATACAACCAATTTAACCGCATCGACACG
CTCTTGTACACATTGGTTTATCCGCAGAGGCCCATGGTAATTACCAAGACGATTGAGCTGATTCACTACGACAAG
CTGCCCGCTGGTCAGAATGCCACTGTTATTGTCATGTCGTTTTCGGGTTACGACATTGAAGATGCGCTTGTGCTA
AACAAGGCATCCATTGACCGGGGCTTTGGGCGCTGCCAAGTCTTCCGCAAGTACACGAGTGAGCTTCAAAAGTAC
CCCAACGGCAGGAGAGAGCGGATTGGAGATCCTGCCAATGAAATGTCTGGAGGTATCAAGCGACGTGTCGAAAAA
TACGGGGCCTTGGATGATGATGGCCTGGCCACAGTGGGGTACAGAGTCAAGAATGGCGACGTCATGGTCAAAAAG
GAGACGCCGCTGGACTTGACAACAACGGGAATAGGCATCGATCGTGGACCAAGCGAGTATCGAGATTCCTCAGTA
GAATATCGCATTCCCGACCCAGCCTATATCGACAAGGTGATGATTTCCCAGACAGAAAAGGACACAACTGTCATC
AAGGTGCAGACGAGGCAGACACGAAGGCCTGAGCTTGGGGACAAGTTTTCGTCTCGGCACGGACAAAAAGGAGTT
GTGGGAATAATTGTTGATCAAGAGGACATGCCCTTTTCGGATAGCGGGCTGACTCCCGATATTATCATGAATCCT
CACGGATTTCCATCACGAATGACAGTCGGCAAACTGCTTGAATGCTTGACAGGAAAGGCGGCCGTTCTGGATGGC
CGCAAAGACTATGGCTTTGGAGATGCCTTTCGGTCGCATCCGGTAGAGGAGATGGGCCAAGTTTTGCTCCGACAT
GGGTTCTCGTGGGAGGGCAAAGACTACTTTACGTCTGGAATGACAGGCGAACCGCTTGAGGCTTACATCTTTAAC
GGCCCAATCTACTACCAGCGGCTTAAGCACATGGTCCAAGACAAGATGCATTCTCGAGCGCGCGGTCCTCGCGCC
ATTCTTACTCGGCAGCCAACCGAAGGTCGTTCACGGTCTGGCGGCCTGAGACTGGGAGAAATGGAGCGCGATTGC
TTGATTGCATACGGAGCGTCGCAACTATTACTGGAGCGACTGATGCTCAGCTCGGACGCAACGGAAATTGACATT
TGCCAGCAATGTGGTCTTTTTGGATACCGTGGATATTGCCATACATGCAAGAGCACTAGAGGGGTGACGAGGATG
ACGATGCCATACGCAGCCAAGCTGCTGGTCCAAGAGCTGATTAGCATGAATGTCGGGGTGCGTCTTCAACTTGAG
GACGAGTTTCCTCATGCAAAATGA
Gene >OphauG2|1289
ATGCCTCCCATCGACGACGGCTTCGAAGCTCTCCTCGAGCCATTTTACAACGGCAAGAAGCTCACAGATCCCGTG
TCGACAAAGGAAGACAAATTCCAATTATTACCAGCTTTTCTCAAAGTCAAGGGTGGGAAGCTTTGCTCTCTACAC
AGCCCATCTATAGCTCTACTGACGCATTCTAGGTCTGGTAAAACAGTACGCGCCTACGACACCTCCATCTTGAAC
CACAAATCTGACAGCGCCCAGGCACATAGACTCGTACAACTTCTTTGTAGAGCACGAAATCAAAGAAATCGTGCG
AGCCAATCGCACCATACGCAGCGATGTGGACAGCAACTTCTGGCTCGAGTACGTTGACCTGCTGGTATAATGAGG
GCAGACATGTGTTGACAAGCATGCCACGTCAGATTCACCGATATACGCGTCGATCAGCCGCGTCGACAAGATCAT
AACGAAGCCAAGTCACGCAGCGATGTCACTCCCATGGAGTGCCGTCTGCGCGACATGACATATGCTGCTCCGATA
CTAGTCAATATAGCCTATATTCGTGATCGTCAAAAGATTGTTCGCAAAAATGTGCCGCTTGGGCGGATGCCAGTT
ATGCTCAAAAGCTGCAAGTGCCGACTCAGTGGAGCCAATAATGCGCAGATGGAGGCCATGAACGAATGCCCCCTC
GACCCCGGTGGCTATTTCATTGTCAATGGAACGGAAAAGGTAATTCTGATCCAAGAGCAATTAAGTAAGAACCGT
GTCATTGTCGAAGCCGACGAGAAAAACAACATCATCTCAGCATCCGTTACCAGCTCAACCCATGAACGCAAATCC
AAAACGTACGTGACGTTGAAAAAGGACAAAATTCTACTTACGCACAACGTTTTGGTCGAGGGAGTCCCCATTGTC
ATTGTTCTCAAGGCTCTAGGAGGCCTCTCGGATTTCGAAATTATGCAGCTCGTGGCGGGCTCGGACGGCAGATAT
CAGGACGAATTTCTCATCAATTTCGACGAGGCTATCAAGGCTGGCATCTTTACCCAGCACCAAGCCCTTGAGTAC
ATTGGCAGCAGGGTAAAGATGGGGTCACGGAGATCCCAGTTCGGATCACAGGCGCGTCGAAATAACGTCGAAGAA
GGATTAGACGCATTGGCCAATCTTGTCATTGCCCATGTACCCATTGAAGGTCTTGATTTCTATCCCAAGGCCATC
TACGTTGCCATGATGACTCGGCGCGTCCTCATGGCCTCGCAGGATTCAAAGCTTGTTGATGACAGAGACTTTGTG
GGCAACAAGCGGCTGGAACTTGCAGGCCAACTGCTCTCTCTAATCTTTGAAGATCTGTTTAAACGATTCATGGTC
GAGGTCAAAATGTCGATTGACAAGTTTCTCAAGAAGAACAACCGAGCCGTGCCGCTGGACGCTGTTCATATGATT
AGCAATCACGCGAACAGCATTGGTCTGGGGATAAATCGTGCCATTCAGACGGGCAACTGGAGCGTCAAGCGCTTC
AACATGAACCGAGCAGGTATAACCCACGTGCTAAGTCGTTTAAGCTACATTAGCGCTCTGGGCATGATGACTCGA
ATCAGCAGCCAATTTGAAAAGACGCGCAAAGTATCAGGCCCCCGTGCGCTGCAGCCGTCGCAATGGGGCATGCTG
TGTCCTTCGGATACACCAGAAGGCGAGGCTTGCGGTCTCGTCAAGAATTTGGCTCTTATGACGCATATTACAACC
AACATTGATGAGACGCCAATCAAGAGATGGATATTCACCCTTGACACTGGGGTTGAGCCTATTCGGAACTTTTCG
GGGGCAGAGATGCATCGCCAGGGCTCATACACGATTCATGTCAACGGGACGCCTTTTGCTCTGACGAGATACCCC
AAACGATTTGCGTCGCGGTTCCGGACGATGCGCCGTCGAGGCTGGATATCCCCTTTTGTCAGCATCAACATCAAT
TCACACTTTAACGCGGTACACATTGCGACTGATGAGGGCCGCATTTGCCGGCCCTACATCATTGTCAAGCACGGC
AGACAGAAGCTCAAGGCAGAACATCTCAAGCTTCTGCAGCTTGGCAAAGTCACGTTTGACGATTTTTTGACCAAT
GGCATCGTCGAGTATCTCGACGTCAACGAGGAAAACGATGCGCTCGTAACTATATACGAGGAGGCCATCACACAG
AGCACTACTCACCTGGAAATCGAGCCCTTTACTATTCTCGGGGCTGTCGCGGGATTAATTCCTTTTCCACACCAT
AACCAGTCTCCTCGAAATACCTACCAGTGCGCCATGGGCAAGCAAGCAATTGGAGCCATTGCATACAACCAATTT
AACCGCATCGACACGCTCTTGTACACATTGGTTTATCCGCAGAGGCCCATGGTAATTACCAAGACGATTGAGCTG
ATTCACTACGACAAGCTGCCCGCTGGTCAGAATGCCACTGTTATTGTCATGTCGTTTTCGGGTTACGACATTGAA
GATGCGCTTGTGCTAAACAAGGCATCCATTGACCGGGGCTTTGGGCGCTGCCAAGTCTTCCGCAAGTACACGAGT
GAGCTTCAAAAGTACCCCAACGGCAGGAGAGAGCGGATTGGAGATCCTGCCAATGAAATGTCTGGAGGTATCAAG
CGACGTGTCGAAAAATACGGGGCCTTGGATGATGATGGCCTGGCCACAGTGGGGTACAGAGTCAAGAATGGCGAC
GTCATGGTCAAAAAGGAGACGCCGCTGGACTTGACAACAACGGGAATAGGCATCGATCGTGGACCAAGCGAGTAT
CGAGATTCCTCAGTAGAATATCGCATTCCCGACCCAGCCTATATCGACAAGGTGATGATTTCCCAGACAGAAAAG
GACACAACTGTCATCAAGGTGCAGACGAGGCAGACACGAAGGCCTGAGCTTGGGGACAAGTTTTCGTCTCGGCAC
GGACAAAAAGGAGTTGTGGGAATAATTGTTGATCAAGAGGACATGCCCTTTTCGGATAGCGGGCTGACTCCCGAT
ATTATCATGAATCCTCACGGATTTCCATCACGAATGACAGTCGGCAAACTGCTTGAATGCTTGACAGGAAAGGCG
GCCGTTCTGGATGGCCGCAAAGACTATGGCTTTGGAGATGCCTTTCGGTCGCATCCGGTAGAGGAGATGGGCCAA
GTTTTGCTCCGACATGGGTTCTCGTGGGAGGGCAAAGACTACTTTACGTCTGGAATGACAGGCGAACCGCTTGAG
GCTTACATCTTTAACGGCCCAATCTACTACCAGCGGCTTAAGCACATGGTCCAAGACAAGATGCATTCTCGAGCG
CGCGGTCCTCGCGCCATTCTTACTCGGCAGCCAACCGAAGGTCGTTCACGGTCTGGCGGCCTGAGACTGGGAGAA
ATGGAGCGCGATTGCTTGATTGCATACGGAGCGTCGCAACTATTACTGGAGCGACTGATGCTCAGCTCGGACGCA
ACGGAAATTGACATTTGCCAGCAATGTGGTCTTTTTGGATACCGTGGATATTGCCATACATGCAAGAGCACTAGA
GGGGTGACGAGGATGACGATGCCATACGCAGCCAAGCTGCTGGTCCAAGAGCTGATTAGCATGAATGTCGGGGTG
CGTCTTCAACTTGAGGACGAGTTTCCTCATGCAAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail