Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1283
Gene name
LocationContig_1379:728..4040
Strand+
Gene length (bp)3312
Transcript length (bp)3237
Coding sequence length (bp)3237
Protein length (aa) 1079

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08638 Med14 Mediator complex subunit MED14 1.7E-65 63 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4R0J9|MED14_MAGO7 Mediator of RNA polymerase II transcription subunit 14 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RGR1 PE=3 SV=1 47 1054 0.0E+00
sp|Q7S154|MED14_NEUCR Mediator of RNA polymerase II transcription subunit 14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgr1 PE=3 SV=2 1 1059 2.0E-178
sp|Q2HDU8|MED14_CHAGB Mediator of RNA polymerase II transcription subunit 14 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RGR1 PE=3 SV=1 49 1059 8.0E-154
sp|Q5AW92|MED14_EMENI Mediator of RNA polymerase II transcription subunit 14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rgr1 PE=3 SV=2 53 613 2.0E-95
sp|Q2UMJ1|MED14_ASPOR Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgr1 PE=3 SV=2 4 607 7.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4R0J9|MED14_MAGO7 Mediator of RNA polymerase II transcription subunit 14 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RGR1 PE=3 SV=1 47 1054 0.0E+00
sp|Q7S154|MED14_NEUCR Mediator of RNA polymerase II transcription subunit 14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgr1 PE=3 SV=2 1 1059 2.0E-178
sp|Q2HDU8|MED14_CHAGB Mediator of RNA polymerase II transcription subunit 14 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RGR1 PE=3 SV=1 49 1059 8.0E-154
sp|Q5AW92|MED14_EMENI Mediator of RNA polymerase II transcription subunit 14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rgr1 PE=3 SV=2 53 613 2.0E-95
sp|Q2UMJ1|MED14_ASPOR Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgr1 PE=3 SV=2 4 607 7.0E-95
sp|Q0CL23|MED14_ASPTN Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rgr1 PE=3 SV=2 53 612 9.0E-93
sp|A2QFK0|MED14_ASPNC Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgr1 PE=3 SV=2 16 611 8.0E-92
sp|A1C5W6|MED14_ASPCL Mediator of RNA polymerase II transcription subunit 14 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rgr1 PE=3 SV=1 55 610 2.0E-86
sp|Q4WH96|MED14_ASPFU Mediator of RNA polymerase II transcription subunit 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rgr1 PE=3 SV=1 3 603 4.0E-86
sp|A1DG38|MED14_NEOFI Mediator of RNA polymerase II transcription subunit 14 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rgr1 PE=3 SV=1 9 603 1.0E-85
sp|Q1DZL3|MED14_COCIM Mediator of RNA polymerase II transcription subunit 14 OS=Coccidioides immitis (strain RS) GN=RGR1 PE=3 SV=2 49 610 5.0E-83
sp|Q6C9Z2|MED14_YARLI Mediator of RNA polymerase II transcription subunit 14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RGR1 PE=3 SV=1 55 600 1.0E-46
sp|A3LZ54|MED14_PICST Mediator of RNA polymerase II transcription subunit 14 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RGR1 PE=3 SV=3 16 608 8.0E-33
sp|Q6BPK1|MED14_DEBHA Mediator of RNA polymerase II transcription subunit 14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RGR1 PE=3 SV=2 55 670 1.0E-31
sp|Q9P7Y4|MED14_SCHPO Mediator of RNA polymerase II transcription subunit 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med14 PE=1 SV=2 53 450 4.0E-28
sp|Q5AG31|MED14_CANAL Mediator of RNA polymerase II transcription subunit 14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RGR1 PE=3 SV=2 53 411 3.0E-26
sp|Q75CZ2|MED14_ASHGO Mediator of RNA polymerase II transcription subunit 14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RGR1 PE=3 SV=2 51 595 8.0E-18
sp|O60244|MED14_HUMAN Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens GN=MED14 PE=1 SV=2 114 369 1.0E-17
sp|Q6CRY2|MED14_KLULA Mediator of RNA polymerase II transcription subunit 14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RGR1 PE=3 SV=1 115 588 1.0E-16
sp|A2ABV5|MED14_MOUSE Mediator of RNA polymerase II transcription subunit 14 OS=Mus musculus GN=Med14 PE=1 SV=1 114 369 2.0E-16
sp|Q6FKA5|MED14_CANGA Mediator of RNA polymerase II transcription subunit 14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RGR1 PE=3 SV=1 53 588 5.0E-15
sp|Q7Q6S8|MED14_ANOGA Mediator of RNA polymerase II transcription subunit 14 OS=Anopheles gambiae GN=MED14 PE=3 SV=5 114 366 5.0E-14
sp|P19263|MED14_YEAST Mediator of RNA polymerase II transcription subunit 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGR1 PE=1 SV=2 6 442 8.0E-14
sp|Q03570|MED14_CAEEL Mediator of RNA polymerase II transcription subunit 14 OS=Caenorhabditis elegans GN=rgr-1 PE=3 SV=6 117 370 1.0E-13
sp|Q61IR6|MED14_CAEBR Mediator of RNA polymerase II transcription subunit 14 OS=Caenorhabditis briggsae GN=rgr-1 PE=3 SV=3 117 370 3.0E-13
sp|Q16U49|MED14_AEDAE Mediator of RNA polymerase II transcription subunit 14 OS=Aedes aegypti GN=MED14 PE=3 SV=2 114 366 6.0E-12
sp|P0CB66|MED14_DICDI Putative mediator of RNA polymerase II transcription subunit 14 OS=Dictyostelium discoideum GN=med14 PE=3 SV=1 64 366 9.0E-11
sp|Q4P0P3|MED14_USTMA Mediator of RNA polymerase II transcription subunit 14 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RGR1 PE=3 SV=2 55 294 2.0E-10
sp|Q9W0P8|MED14_DROME Mediator of RNA polymerase II transcription subunit 14 OS=Drosophila melanogaster GN=MED14 PE=1 SV=4 114 366 1.0E-07
sp|Q29FF7|MED14_DROPS Mediator of RNA polymerase II transcription subunit 14 OS=Drosophila pseudoobscura pseudoobscura GN=MED14 PE=3 SV=2 114 366 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0032991 protein-containing complex No
GO:0006355 regulation of transcription, DNA-templated No
GO:0009889 regulation of biosynthetic process No
GO:0005575 cellular_component No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1283
MEPGGHQGTRTNHDRNGVNGSSAAAHAQQPRDAEDARPPPPDAKACLRMNDLPDDIVHITHGFVPLSLLLGRLAQ
VSHNSLQDKIAELAKMALPTTAVNGAPASPSADDVSTDNLRKKSSLASFAQDMHAKWLKALVITEWSRQSHHVSK
LIDLKFHIDQQRMVYDAALDHMANIKRDLTYARMPSPDLKTALQVLSTGSAPWMPDANYIEPPPLTPEDQLKWID
DLNTLLALRLNLDDFDRLPHAFRHYHISSGRVTFKVEGEFELDLTIADEDFDKQFWFIDFRYDFCPAASSLPPSL
MAYLEAHVNQILAHGGLAGCHHFLHEFVLTCKINELKRQALQLSRNLWSGTLVVEPLNRALAMQYWSARSAVTGT
KNWILVAVSSGRQRDHGHGDTATWSSLVVKWYRDNQEVKNVCITLDAKVVSADSLLKQVVGRHIEFILNGIRDKL
MEAPRRLSKASSVRVKTSLSDPAASYLVLQDGFKERVVLLLEPMTGACSLMPCSRLVTPFENQLNSSKLRAEDGV
ACLENVRCAMVEEELMRRGGLMGWFPRKPALSLDDIRWATKLHDWTRAVWFRNVGWDPDWFLVALLSLAGDEWWL
LQVSEPTGPARNRDALGRASPVEFKAKLALGPGHADRWGQFWTHAGVLVTSIMVQSLDVAELQRNGIQCCIQNSG
TQDDAPRGRQTRLVSSCVSLSAMFPSMVVGKHHKTASGPGMDSKDNIKSLSLMEAYTGARLVHRQAWADDSMVVT
YKHLQIPPRPERGVGIFHEQVMVVDAVIKIDKSQLLKGLGATRCGDMAYIASQGTFIIRLRRALGQPMLKRIKSC
IRVIDRLVTYIRALDRAKACIDGEVANIGRVMFRYGGAPKGQGESDSKQEQGQTRRPWRVLLDLSKDDIDVAVDN
DSPHVAVEDFLRILVNKEEGIGALMVWLPASVAILQTIQTVSAAWRRSNGEERVRLRLTMKTVAWLSICYVIGAG
TKQRRISFDVNLRADAAGPWWYIARSDAGANGEHPDDVGKALQAVWDGSGREWSGFGSSARGSPLCGVTPMLMAV
DDAIGRVVGRVNTSGASAPADQHVVVLE*
Coding >OphauG2|1283
ATGGAACCTGGAGGCCACCAAGGCACGCGCACAAACCACGATCGGAATGGAGTCAATGGTTCCAGCGCTGCAGCC
CACGCGCAACAGCCCCGAGACGCAGAGGATGCTCGCCCCCCGCCCCCCGATGCCAAGGCGTGCTTGAGGATGAAC
GACCTGCCCGACGACATTGTGCACATCACACATGGCTTTGTGCCGCTGTCTCTGCTGCTCGGCCGCCTGGCCCAG
GTGTCGCACAACTCGCTGCAGGACAAGATTGCCGAGCTGGCCAAGATGGCTCTGCCCACCACCGCCGTCAATGGC
GCCCCGGCCTCTCCCTCTGCCGACGACGTCTCGACAGACAACCTGCGCAAGAAGAGCAGCCTGGCCTCCTTTGCC
CAAGACATGCACGCAAAGTGGCTCAAGGCCCTCGTCATTACGGAATGGAGCCGCCAGTCGCATCATGTCAGCAAG
CTCATTGACCTCAAGTTCCACATTGACCAGCAAAGAATGGTCTATGACGCGGCTCTCGACCACATGGCCAACATC
AAGCGCGACTTGACCTATGCGCGCATGCCAAGCCCCGACTTGAAGACGGCCTTGCAAGTCTTGTCGACTGGAAGC
GCGCCGTGGATGCCAGATGCCAACTATATCGAGCCGCCACCTCTGACGCCAGAGGACCAGCTCAAGTGGATTGAC
GACCTCAATACCTTGCTCGCCCTGAGACTCAATCTTGACGATTTCGACAGACTCCCCCATGCTTTTCGCCACTAC
CACATATCATCGGGAAGAGTCACCTTTAAAGTTGAAGGAGAATTCGAGCTTGACCTTACCATTGCAGACGAGGAT
TTCGACAAGCAATTTTGGTTTATTGATTTTCGCTACGACTTTTGCCCCGCCGCCTCGTCTCTTCCCCCCTCTCTC
ATGGCCTATCTTGAAGCTCATGTCAACCAGATACTTGCCCATGGCGGCTTGGCCGGATGCCATCACTTTTTGCAT
GAATTCGTTCTGACGTGCAAGATCAATGAGCTCAAGCGCCAGGCGCTACAGCTGAGCAGAAACTTGTGGAGCGGG
ACGCTCGTGGTGGAACCGCTCAACCGCGCACTGGCCATGCAGTACTGGAGCGCCCGAAGCGCCGTGACAGGAACC
AAGAACTGGATCCTGGTGGCCGTCAGCAGTGGGCGCCAGCGCGACCATGGCCATGGCGACACGGCAACGTGGAGC
AGTCTGGTGGTAAAATGGTATCGCGACAACCAAGAGGTCAAAAATGTTTGTATAACGCTCGACGCCAAAGTCGTA
TCCGCAGACTCCCTGCTCAAGCAGGTTGTCGGTCGACACATTGAATTCATCCTCAACGGCATCCGAGACAAGCTC
ATGGAAGCCCCTCGGCGCCTGAGCAAGGCATCAAGCGTCAGGGTCAAGACGTCTCTGTCAGATCCCGCTGCTTCC
TATTTGGTGCTGCAAGACGGCTTCAAGGAAAGGGTGGTGCTTCTGCTGGAGCCAATGACTGGGGCCTGCTCTCTC
ATGCCTTGCTCAAGACTTGTCACGCCCTTTGAGAACCAGCTCAACAGCAGCAAGCTGCGAGCCGAAGATGGGGTG
GCGTGCCTAGAAAACGTGCGATGCGCCATGGTTGAGGAGGAGCTTATGAGGCGCGGCGGCCTCATGGGCTGGTTC
CCGCGCAAGCCAGCCCTGAGCCTCGACGACATCAGATGGGCAACCAAGCTTCACGACTGGACTCGAGCCGTCTGG
TTCCGCAACGTTGGCTGGGATCCAGACTGGTTCCTGGTGGCCTTGTTGAGCCTGGCGGGCGATGAGTGGTGGCTC
CTACAAGTGTCGGAGCCAACGGGGCCAGCCAGAAACCGCGACGCCCTGGGCCGGGCTTCGCCAGTCGAGTTCAAG
GCAAAGCTTGCGCTTGGCCCTGGTCACGCTGATAGATGGGGCCAGTTTTGGACTCATGCGGGCGTCCTTGTCACG
AGCATCATGGTTCAGTCTCTAGACGTGGCGGAACTGCAGCGCAACGGCATCCAATGTTGCATCCAGAACTCAGGC
ACCCAAGACGATGCGCCACGGGGCCGGCAGACGCGCCTGGTATCGAGCTGCGTTTCCCTCTCGGCCATGTTCCCG
TCCATGGTTGTGGGTAAGCACCACAAGACGGCAAGCGGGCCCGGCATGGACAGTAAGGATAACATCAAGAGCCTG
TCGCTCATGGAAGCCTACACCGGGGCAAGACTGGTACACAGACAGGCCTGGGCTGATGACTCCATGGTTGTCACA
TACAAGCACCTGCAAATCCCACCTCGGCCGGAAAGAGGGGTCGGGATTTTCCACGAGCAGGTCATGGTGGTGGAC
GCCGTCATTAAGATTGACAAATCGCAATTGCTCAAGGGGCTTGGTGCGACGCGTTGCGGCGACATGGCCTACATT
GCGTCCCAAGGCACGTTTATCATTCGGCTGCGGAGAGCACTCGGACAGCCCATGCTCAAGCGCATCAAGTCATGC
ATCAGAGTGATTGACCGCCTGGTCACTTATATCAGGGCTTTGGATAGGGCCAAGGCTTGCATTGACGGCGAGGTT
GCGAATATCGGGCGCGTCATGTTTCGCTACGGAGGCGCTCCAAAGGGCCAGGGCGAGAGCGACAGCAAGCAAGAG
CAGGGCCAGACGCGCAGACCATGGCGCGTCTTGCTTGACCTGTCCAAGGACGACATTGACGTGGCGGTGGACAAT
GACAGCCCGCATGTGGCGGTGGAGGATTTCCTCAGGATACTGGTGAATAAAGAAGAAGGCATCGGGGCCCTCATG
GTTTGGCTGCCTGCATCCGTGGCCATTCTCCAGACAATCCAGACAGTGTCTGCTGCGTGGCGGCGGTCGAATGGC
GAGGAGCGCGTCAGGCTGAGGTTGACCATGAAGACGGTGGCGTGGCTTAGCATTTGCTACGTGATTGGAGCTGGG
ACAAAGCAGAGACGCATTTCTTTTGACGTGAACCTCAGGGCCGATGCCGCTGGGCCCTGGTGGTACATTGCGCGG
TCGGATGCGGGAGCAAATGGCGAGCACCCAGACGACGTGGGCAAGGCTTTGCAGGCGGTCTGGGACGGCAGCGGA
AGGGAGTGGAGCGGCTTTGGCTCCAGTGCGCGAGGGTCTCCGTTATGCGGAGTCACGCCTATGCTCATGGCTGTT
GATGATGCCATTGGACGTGTCGTGGGACGCGTCAACACTAGTGGAGCGAGTGCGCCTGCGGACCAGCATGTCGTG
GTACTGGAGTGA
Transcript >OphauG2|1283
ATGGAACCTGGAGGCCACCAAGGCACGCGCACAAACCACGATCGGAATGGAGTCAATGGTTCCAGCGCTGCAGCC
CACGCGCAACAGCCCCGAGACGCAGAGGATGCTCGCCCCCCGCCCCCCGATGCCAAGGCGTGCTTGAGGATGAAC
GACCTGCCCGACGACATTGTGCACATCACACATGGCTTTGTGCCGCTGTCTCTGCTGCTCGGCCGCCTGGCCCAG
GTGTCGCACAACTCGCTGCAGGACAAGATTGCCGAGCTGGCCAAGATGGCTCTGCCCACCACCGCCGTCAATGGC
GCCCCGGCCTCTCCCTCTGCCGACGACGTCTCGACAGACAACCTGCGCAAGAAGAGCAGCCTGGCCTCCTTTGCC
CAAGACATGCACGCAAAGTGGCTCAAGGCCCTCGTCATTACGGAATGGAGCCGCCAGTCGCATCATGTCAGCAAG
CTCATTGACCTCAAGTTCCACATTGACCAGCAAAGAATGGTCTATGACGCGGCTCTCGACCACATGGCCAACATC
AAGCGCGACTTGACCTATGCGCGCATGCCAAGCCCCGACTTGAAGACGGCCTTGCAAGTCTTGTCGACTGGAAGC
GCGCCGTGGATGCCAGATGCCAACTATATCGAGCCGCCACCTCTGACGCCAGAGGACCAGCTCAAGTGGATTGAC
GACCTCAATACCTTGCTCGCCCTGAGACTCAATCTTGACGATTTCGACAGACTCCCCCATGCTTTTCGCCACTAC
CACATATCATCGGGAAGAGTCACCTTTAAAGTTGAAGGAGAATTCGAGCTTGACCTTACCATTGCAGACGAGGAT
TTCGACAAGCAATTTTGGTTTATTGATTTTCGCTACGACTTTTGCCCCGCCGCCTCGTCTCTTCCCCCCTCTCTC
ATGGCCTATCTTGAAGCTCATGTCAACCAGATACTTGCCCATGGCGGCTTGGCCGGATGCCATCACTTTTTGCAT
GAATTCGTTCTGACGTGCAAGATCAATGAGCTCAAGCGCCAGGCGCTACAGCTGAGCAGAAACTTGTGGAGCGGG
ACGCTCGTGGTGGAACCGCTCAACCGCGCACTGGCCATGCAGTACTGGAGCGCCCGAAGCGCCGTGACAGGAACC
AAGAACTGGATCCTGGTGGCCGTCAGCAGTGGGCGCCAGCGCGACCATGGCCATGGCGACACGGCAACGTGGAGC
AGTCTGGTGGTAAAATGGTATCGCGACAACCAAGAGGTCAAAAATGTTTGTATAACGCTCGACGCCAAAGTCGTA
TCCGCAGACTCCCTGCTCAAGCAGGTTGTCGGTCGACACATTGAATTCATCCTCAACGGCATCCGAGACAAGCTC
ATGGAAGCCCCTCGGCGCCTGAGCAAGGCATCAAGCGTCAGGGTCAAGACGTCTCTGTCAGATCCCGCTGCTTCC
TATTTGGTGCTGCAAGACGGCTTCAAGGAAAGGGTGGTGCTTCTGCTGGAGCCAATGACTGGGGCCTGCTCTCTC
ATGCCTTGCTCAAGACTTGTCACGCCCTTTGAGAACCAGCTCAACAGCAGCAAGCTGCGAGCCGAAGATGGGGTG
GCGTGCCTAGAAAACGTGCGATGCGCCATGGTTGAGGAGGAGCTTATGAGGCGCGGCGGCCTCATGGGCTGGTTC
CCGCGCAAGCCAGCCCTGAGCCTCGACGACATCAGATGGGCAACCAAGCTTCACGACTGGACTCGAGCCGTCTGG
TTCCGCAACGTTGGCTGGGATCCAGACTGGTTCCTGGTGGCCTTGTTGAGCCTGGCGGGCGATGAGTGGTGGCTC
CTACAAGTGTCGGAGCCAACGGGGCCAGCCAGAAACCGCGACGCCCTGGGCCGGGCTTCGCCAGTCGAGTTCAAG
GCAAAGCTTGCGCTTGGCCCTGGTCACGCTGATAGATGGGGCCAGTTTTGGACTCATGCGGGCGTCCTTGTCACG
AGCATCATGGTTCAGTCTCTAGACGTGGCGGAACTGCAGCGCAACGGCATCCAATGTTGCATCCAGAACTCAGGC
ACCCAAGACGATGCGCCACGGGGCCGGCAGACGCGCCTGGTATCGAGCTGCGTTTCCCTCTCGGCCATGTTCCCG
TCCATGGTTGTGGGTAAGCACCACAAGACGGCAAGCGGGCCCGGCATGGACAGTAAGGATAACATCAAGAGCCTG
TCGCTCATGGAAGCCTACACCGGGGCAAGACTGGTACACAGACAGGCCTGGGCTGATGACTCCATGGTTGTCACA
TACAAGCACCTGCAAATCCCACCTCGGCCGGAAAGAGGGGTCGGGATTTTCCACGAGCAGGTCATGGTGGTGGAC
GCCGTCATTAAGATTGACAAATCGCAATTGCTCAAGGGGCTTGGTGCGACGCGTTGCGGCGACATGGCCTACATT
GCGTCCCAAGGCACGTTTATCATTCGGCTGCGGAGAGCACTCGGACAGCCCATGCTCAAGCGCATCAAGTCATGC
ATCAGAGTGATTGACCGCCTGGTCACTTATATCAGGGCTTTGGATAGGGCCAAGGCTTGCATTGACGGCGAGGTT
GCGAATATCGGGCGCGTCATGTTTCGCTACGGAGGCGCTCCAAAGGGCCAGGGCGAGAGCGACAGCAAGCAAGAG
CAGGGCCAGACGCGCAGACCATGGCGCGTCTTGCTTGACCTGTCCAAGGACGACATTGACGTGGCGGTGGACAAT
GACAGCCCGCATGTGGCGGTGGAGGATTTCCTCAGGATACTGGTGAATAAAGAAGAAGGCATCGGGGCCCTCATG
GTTTGGCTGCCTGCATCCGTGGCCATTCTCCAGACAATCCAGACAGTGTCTGCTGCGTGGCGGCGGTCGAATGGC
GAGGAGCGCGTCAGGCTGAGGTTGACCATGAAGACGGTGGCGTGGCTTAGCATTTGCTACGTGATTGGAGCTGGG
ACAAAGCAGAGACGCATTTCTTTTGACGTGAACCTCAGGGCCGATGCCGCTGGGCCCTGGTGGTACATTGCGCGG
TCGGATGCGGGAGCAAATGGCGAGCACCCAGACGACGTGGGCAAGGCTTTGCAGGCGGTCTGGGACGGCAGCGGA
AGGGAGTGGAGCGGCTTTGGCTCCAGTGCGCGAGGGTCTCCGTTATGCGGAGTCACGCCTATGCTCATGGCTGTT
GATGATGCCATTGGACGTGTCGTGGGACGCGTCAACACTAGTGGAGCGAGTGCGCCTGCGGACCAGCATGTCGTG
GTACTGGAGTGA
Gene >OphauG2|1283
ATGGAACCTGGAGGCCACCAAGGCACGCGCACAAACCACGATCGGAATGGAGTCAATGGTTCCAGCGCTGCAGCC
CACGCGCAACAGCCCCGAGACGCAGAGGATGCTCGCCCCCCGCCCCCCGATGCCAAGGCGTGCTTGAGGATGAAC
GACCTGCCCGACGACATTGTGCACATCACACATGGCTTTGTGCCGCTGTCTCTGCTGCTCGGCCGCCTGGCCCAG
GTGTCGCACAACTCGCTGCAGGACAAGATTGCCGAGCTGGCCAAGATGGCTCTGCCCACCACCGCCGTCAATGGC
GCCCCGGCCTCTCCCTCTGCCGACGACGTCTCGACAGACAACCTGCGCAAGAAGAGCAGCCTGGCCTCCTTTGCC
CAAGACATGCACGCAAAGTGGCTCAAGGCCCTCGTCATTACGGAATGGAGCCGCCAGTCGCATCATGTCAGCAAG
CTCATTGACCTCAAGTTCCACATTGACCAGCAAAGAATGGTCTATGACGCGGCTCTCGACCACATGGCCAACATC
AAGCGCGACTTGACCTATGCGCGCATGCCAAGCCCCGACTTGAAGACGGCCTTGCAAGTCTTGTCGACTGGAAGC
GCGCCGTGGATGCCAGATGTAAGCATGCTCTCCGTCTTGCCACGTGCCAGCAGCAATACAACCTCTGCTCCCTTA
CTCACCCTCCTGTCCCAGGCCAACTATATCGAGCCGCCACCTCTGACGCCAGAGGACCAGCTCAAGTGGATTGAC
GACCTCAATACCTTGCTCGCCCTGAGACTCAATCTTGACGATTTCGACAGACTCCCCCATGCTTTTCGCCACTAC
CACATATCATCGGGAAGAGTCACCTTTAAAGTTGAAGGAGAATTCGAGCTTGACCTTACCATTGCAGACGAGGAT
TTCGACAAGCAATTTTGGTTTATTGATTTTCGCTACGACTTTTGCCCCGCCGCCTCGTCTCTTCCCCCCTCTCTC
ATGGCCTATCTTGAAGCTCATGTCAACCAGATACTTGCCCATGGCGGCTTGGCCGGATGCCATCACTTTTTGCAT
GAATTCGTTCTGACGTGCAAGATCAATGAGCTCAAGCGCCAGGCGCTACAGCTGAGCAGAAACTTGTGGAGCGGG
ACGCTCGTGGTGGAACCGCTCAACCGCGCACTGGCCATGCAGTACTGGAGCGCCCGAAGCGCCGTGACAGGAACC
AAGAACTGGATCCTGGTGGCCGTCAGCAGTGGGCGCCAGCGCGACCATGGCCATGGCGACACGGCAACGTGGAGC
AGTCTGGTGGTAAAATGGTATCGCGACAACCAAGAGGTCAAAAATGTTTGTATAACGCTCGACGCCAAAGTCGTA
TCCGCAGACTCCCTGCTCAAGCAGGTTGTCGGTCGACACATTGAATTCATCCTCAACGGCATCCGAGACAAGCTC
ATGGAAGCCCCTCGGCGCCTGAGCAAGGCATCAAGCGTCAGGGTCAAGACGTCTCTGTCAGATCCCGCTGCTTCC
TATTTGGTGCTGCAAGACGGCTTCAAGGAAAGGGTGGTGCTTCTGCTGGAGCCAATGACTGGGGCCTGCTCTCTC
ATGCCTTGCTCAAGACTTGTCACGCCCTTTGAGAACCAGCTCAACAGCAGCAAGCTGCGAGCCGAAGATGGGGTG
GCGTGCCTAGAAAACGTGCGATGCGCCATGGTTGAGGAGGAGCTTATGAGGCGCGGCGGCCTCATGGGCTGGTTC
CCGCGCAAGCCAGCCCTGAGCCTCGACGACATCAGATGGGCAACCAAGCTTCACGACTGGACTCGAGCCGTCTGG
TTCCGCAACGTTGGCTGGGATCCAGACTGGTTCCTGGTGGCCTTGTTGAGCCTGGCGGGCGATGAGTGGTGGCTC
CTACAAGTGTCGGAGCCAACGGGGCCAGCCAGAAACCGCGACGCCCTGGGCCGGGCTTCGCCAGTCGAGTTCAAG
GCAAAGCTTGCGCTTGGCCCTGGTCACGCTGATAGATGGGGCCAGTTTTGGACTCATGCGGGCGTCCTTGTCACG
AGCATCATGGTTCAGTCTCTAGACGTGGCGGAACTGCAGCGCAACGGCATCCAATGTTGCATCCAGAACTCAGGC
ACCCAAGACGATGCGCCACGGGGCCGGCAGACGCGCCTGGTATCGAGCTGCGTTTCCCTCTCGGCCATGTTCCCG
TCCATGGTTGTGGGTAAGCACCACAAGACGGCAAGCGGGCCCGGCATGGACAGTAAGGATAACATCAAGAGCCTG
TCGCTCATGGAAGCCTACACCGGGGCAAGACTGGTACACAGACAGGCCTGGGCTGATGACTCCATGGTTGTCACA
TACAAGCACCTGCAAATCCCACCTCGGCCGGAAAGAGGGGTCGGGATTTTCCACGAGCAGGTCATGGTGGTGGAC
GCCGTCATTAAGATTGACAAATCGCAATTGCTCAAGGGGCTTGGTGCGACGCGTTGCGGCGACATGGCCTACATT
GCGTCCCAAGGCACGTTTATCATTCGGCTGCGGAGAGCACTCGGACAGCCCATGCTCAAGCGCATCAAGTCATGC
ATCAGAGTGATTGACCGCCTGGTCACTTATATCAGGGCTTTGGATAGGGCCAAGGCTTGCATTGACGGCGAGGTT
GCGAATATCGGGCGCGTCATGTTTCGCTACGGAGGCGCTCCAAAGGGCCAGGGCGAGAGCGACAGCAAGCAAGAG
CAGGGCCAGACGCGCAGACCATGGCGCGTCTTGCTTGACCTGTCCAAGGACGACATTGACGTGGCGGTGGACAAT
GACAGCCCGCATGTGGCGGTGGAGGATTTCCTCAGGATACTGGTGAATAAAGAAGAAGGCATCGGGGCCCTCATG
GTTTGGCTGCCTGCATCCGTGGCCATTCTCCAGACAATCCAGACAGTGTCTGCTGCGTGGCGGCGGTCGAATGGC
GAGGAGCGCGTCAGGCTGAGGTTGACCATGAAGACGGTGGCGTGGCTTAGCATTTGCTACGTGATTGGAGCTGGG
ACAAAGCAGAGACGCATTTCTTTTGACGTGAACCTCAGGGCCGATGCCGCTGGGCCCTGGTGGTACATTGCGCGG
TCGGATGCGGGAGCAAATGGCGAGCACCCAGACGACGTGGGCAAGGCTTTGCAGGCGGTCTGGGACGGCAGCGGA
AGGGAGTGGAGCGGCTTTGGCTCCAGTGCGCGAGGGTCTCCGTTATGCGGAGTCACGCCTATGCTCATGGCTGTT
GATGATGCCATTGGACGTGTCGTGGGACGCGTCAACACTAGTGGAGCGAGTGCGCCTGCGGACCAGCATGTCGTG
GTACTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail