Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1281
Gene name
LocationContig_1378:464..2686
Strand+
Gene length (bp)2222
Transcript length (bp)2106
Coding sequence length (bp)2106
Protein length (aa) 702

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03828 PAP_assoc Cid1 family poly A polymerase 5.7E-12 572 629
PF01909 NTP_transf_2 Nucleotidyltransferase domain 9.0E-07 405 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 352 659 1.0E-51
sp|Q9HFW3|TRF5_ASHGO Poly(A) RNA polymerase protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRF5 PE=3 SV=1 352 659 1.0E-50
sp|Q9UTN3|CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid14 PE=1 SV=2 351 668 7.0E-50
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 352 685 7.0E-49
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 352 672 4.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 352 659 1.0E-51
sp|Q9HFW3|TRF5_ASHGO Poly(A) RNA polymerase protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRF5 PE=3 SV=1 352 659 1.0E-50
sp|Q9UTN3|CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid14 PE=1 SV=2 351 668 7.0E-50
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 352 685 7.0E-49
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 352 672 4.0E-47
sp|Q8NDF8|PAPD5_HUMAN Non-canonical poly(A) RNA polymerase PAPD5 OS=Homo sapiens GN=PAPD5 PE=1 SV=2 352 672 8.0E-47
sp|Q5XG87|PAPD7_HUMAN Non-canonical poly(A) RNA polymerase PAPD7 OS=Homo sapiens GN=PAPD7 PE=1 SV=3 368 661 2.0E-43
sp|Q6PB75|PAPD7_MOUSE Non-canonical poly(A) RNA polymerase PAPD7 OS=Mus musculus GN=Papd7 PE=2 SV=2 385 661 5.0E-37
sp|G5EFL0|GLD4_CAEEL Poly(A) RNA polymerase gld-4 OS=Caenorhabditis elegans GN=gld-4 PE=1 SV=1 368 673 1.0E-33
sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-b PE=1 SV=1 367 666 4.0E-10
sp|O74326|CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid11 PE=3 SV=1 367 679 1.0E-09
sp|O64642|URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana GN=URT1 PE=1 SV=2 367 581 1.0E-09
sp|Q641A1|GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-a PE=1 SV=1 367 629 3.0E-09
sp|O74518|CID12_SCHPO Poly(A) RNA polymerase cid12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid12 PE=1 SV=1 375 645 2.0E-08
sp|Q5XET5|HESO1_ARATH Protein HESO1 OS=Arabidopsis thaliana GN=HESO1 PE=1 SV=1 374 557 2.0E-08
sp|Q0VFA3|GLD2_XENTR Poly(A) RNA polymerase GLD2 OS=Xenopus tropicalis GN=papd4 PE=2 SV=1 367 598 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016779 nucleotidyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3504
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1281 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4572
Ophiocordyceps camponoti-floridani Ophcf2|01660
Ophiocordyceps camponoti-rufipedis Ophun1|201
Ophiocordyceps kimflemingae Ophio5|3694
Ophiocordyceps subramaniannii Hirsu2|6706

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1281
MSRRNEPPSRRGDDLYDSWRPLSNQHSHDSYRAGPDSHRPSHSNRAYESYRPSASSAPESRSRSYQHTYQPPQPP
QSDFTFRLDYPHTSFTPINPGAKRPSQAPRRSDRDRPRRVPASQSRPRWKPPHPYERALISGNTSVQPSERLHEN
GAKFRNPDDLSDDNEVDMVISSSESASDKPAKKRVRIDGNVGNDDTPKWSNPDPYTALPCPDETRRKKSDVVQLI
RKARVEETKPAVETVPEAENFLSFDLSASEGETKEVLPTRSSLPGSHSLPSSLPPRPPVPEVPPPSVPTVDRPLA
PDRSGPLGSRKRTADDVIKPPDYGKLNKTNMKPSKGNLMAQWEPKAGQDLCPWVLTNHASETNMAVRLHKEIVDF
YDFVRPKKFEQCIRENLVQNLQNAMRRDPRFSSATMHAFGSYMSGLYLPTADMDLVVCSATYMSGGPPAFLGARS
WLHKFAHFLVVQKICDKETVEVISRARVPLVKFVDTLTGLRVDVSFENLGGVQAIDTFLQWKTDYPAMPALVTVV
KHFLLMRGLNEPVNGGIGGFSVICLVVSMLQVLPHIQSRSAASAHHLGELLLIFFELYGRHFRYDKVAISLRDPI
GYVRKSEVLSLTYRNTDRLSIIDPNNASNDITGGASNTGAIMGCFHDAFVALTDRMREVARQPGNGGILDILLEG
DYSSFRMQRRYLKHVYEGVFGPCQDE*
Coding >OphauG2|1281
ATGTCTAGACGCAACGAACCGCCCTCGCGGCGTGGCGATGATCTTTACGATAGCTGGCGTCCGCTCAGCAATCAG
CATAGCCACGATTCTTATCGAGCAGGACCAGACTCGCATCGCCCGTCCCACTCAAATCGGGCATATGAGTCGTAT
CGCCCCTCGGCTTCCTCTGCCCCCGAGTCTCGCAGCCGCTCCTACCAACACACCTACCAGCCACCCCAGCCTCCA
CAATCAGACTTTACCTTTCGTCTTGATTATCCTCACACAAGCTTCACTCCCATCAATCCCGGAGCAAAAAGGCCC
AGCCAAGCGCCCCGCAGGTCTGACCGTGACCGCCCTAGGCGCGTGCCTGCTTCCCAGAGCCGTCCTCGTTGGAAA
CCTCCCCATCCCTATGAGCGTGCCTTGATATCTGGCAACACTTCGGTGCAGCCCAGCGAGCGTCTCCACGAGAAC
GGTGCCAAGTTTCGCAACCCCGACGACCTGTCAGACGACAACGAGGTTGACATGGTCATATCTTCGTCTGAATCG
GCATCTGACAAGCCAGCCAAGAAGCGGGTGCGAATAGACGGCAACGTGGGTAATGACGATACTCCCAAGTGGTCC
AATCCTGATCCATATACGGCCCTTCCATGCCCTGACGAGACACGCCGCAAGAAGTCTGACGTGGTTCAACTGATT
CGCAAGGCGCGTGTTGAAGAAACTAAGCCAGCTGTTGAGACTGTCCCCGAGGCTGAAAACTTTTTGTCCTTTGAT
CTTTCGGCTAGCGAGGGCGAGACCAAAGAGGTGCTTCCCACCAGGAGCTCTCTCCCAGGCTCGCATTCACTGCCA
TCTAGTCTTCCGCCCCGCCCCCCAGTCCCTGAGGTACCCCCCCCTTCTGTGCCCACCGTCGACAGGCCACTAGCC
CCGGACCGCTCAGGTCCCCTGGGCTCACGCAAGCGCACTGCAGACGACGTGATCAAGCCTCCAGACTACGGCAAG
CTTAACAAGACCAACATGAAGCCCTCCAAGGGCAATCTGATGGCGCAGTGGGAGCCCAAGGCGGGCCAAGACTTG
TGCCCTTGGGTCTTGACAAACCATGCCAGTGAGACCAATATGGCGGTTCGGCTACATAAAGAAATTGTGGATTTT
TACGACTTTGTTCGGCCCAAAAAGTTTGAGCAGTGCATTCGTGAAAACCTTGTCCAAAACCTGCAAAACGCTATG
CGTCGCGACCCACGTTTCTCGTCGGCCACGATGCACGCGTTTGGCTCCTACATGTCGGGCCTGTACCTGCCAACC
GCTGACATGGACCTTGTCGTTTGCTCGGCAACCTACATGTCGGGAGGGCCGCCAGCCTTTCTCGGCGCCAGGTCT
TGGCTGCACAAGTTTGCCCACTTTCTTGTTGTGCAGAAAATATGCGACAAGGAAACTGTCGAAGTCATTTCGCGA
GCTCGCGTTCCGCTGGTCAAGTTTGTTGACACCTTGACTGGCCTCAGGGTCGACGTTTCCTTTGAGAACTTGGGC
GGCGTTCAGGCAATTGATACCTTTTTGCAATGGAAAACCGACTACCCCGCCATGCCAGCGCTTGTGACCGTGGTC
AAACACTTTCTGCTCATGCGTGGTCTTAATGAGCCGGTCAATGGCGGAATTGGAGGTTTCTCAGTCATTTGCCTC
GTTGTCAGCATGCTCCAAGTTCTGCCGCACATTCAAAGCCGCAGCGCTGCCAGCGCCCATCATTTGGGGGAGCTA
CTTCTCATCTTCTTTGAGCTCTATGGTCGCCATTTTCGGTACGACAAAGTTGCTATTTCCCTCAGGGATCCCATT
GGTTATGTGCGAAAGTCGGAAGTCTTGAGCTTGACATATCGCAACACGGATAGGCTGTCGATTATCGATCCCAAC
AATGCGTCAAACGACATTACGGGAGGCGCATCCAACACGGGCGCAATAATGGGTTGCTTCCACGATGCCTTTGTT
GCCCTGACTGATCGAATGCGAGAGGTGGCCCGGCAGCCGGGAAATGGCGGCATCCTCGACATCCTACTGGAAGGG
GATTACTCATCATTTCGAATGCAACGGCGATATCTGAAGCACGTTTACGAAGGCGTGTTTGGGCCCTGTCAGGAC
GAATGA
Transcript >OphauG2|1281
ATGTCTAGACGCAACGAACCGCCCTCGCGGCGTGGCGATGATCTTTACGATAGCTGGCGTCCGCTCAGCAATCAG
CATAGCCACGATTCTTATCGAGCAGGACCAGACTCGCATCGCCCGTCCCACTCAAATCGGGCATATGAGTCGTAT
CGCCCCTCGGCTTCCTCTGCCCCCGAGTCTCGCAGCCGCTCCTACCAACACACCTACCAGCCACCCCAGCCTCCA
CAATCAGACTTTACCTTTCGTCTTGATTATCCTCACACAAGCTTCACTCCCATCAATCCCGGAGCAAAAAGGCCC
AGCCAAGCGCCCCGCAGGTCTGACCGTGACCGCCCTAGGCGCGTGCCTGCTTCCCAGAGCCGTCCTCGTTGGAAA
CCTCCCCATCCCTATGAGCGTGCCTTGATATCTGGCAACACTTCGGTGCAGCCCAGCGAGCGTCTCCACGAGAAC
GGTGCCAAGTTTCGCAACCCCGACGACCTGTCAGACGACAACGAGGTTGACATGGTCATATCTTCGTCTGAATCG
GCATCTGACAAGCCAGCCAAGAAGCGGGTGCGAATAGACGGCAACGTGGGTAATGACGATACTCCCAAGTGGTCC
AATCCTGATCCATATACGGCCCTTCCATGCCCTGACGAGACACGCCGCAAGAAGTCTGACGTGGTTCAACTGATT
CGCAAGGCGCGTGTTGAAGAAACTAAGCCAGCTGTTGAGACTGTCCCCGAGGCTGAAAACTTTTTGTCCTTTGAT
CTTTCGGCTAGCGAGGGCGAGACCAAAGAGGTGCTTCCCACCAGGAGCTCTCTCCCAGGCTCGCATTCACTGCCA
TCTAGTCTTCCGCCCCGCCCCCCAGTCCCTGAGGTACCCCCCCCTTCTGTGCCCACCGTCGACAGGCCACTAGCC
CCGGACCGCTCAGGTCCCCTGGGCTCACGCAAGCGCACTGCAGACGACGTGATCAAGCCTCCAGACTACGGCAAG
CTTAACAAGACCAACATGAAGCCCTCCAAGGGCAATCTGATGGCGCAGTGGGAGCCCAAGGCGGGCCAAGACTTG
TGCCCTTGGGTCTTGACAAACCATGCCAGTGAGACCAATATGGCGGTTCGGCTACATAAAGAAATTGTGGATTTT
TACGACTTTGTTCGGCCCAAAAAGTTTGAGCAGTGCATTCGTGAAAACCTTGTCCAAAACCTGCAAAACGCTATG
CGTCGCGACCCACGTTTCTCGTCGGCCACGATGCACGCGTTTGGCTCCTACATGTCGGGCCTGTACCTGCCAACC
GCTGACATGGACCTTGTCGTTTGCTCGGCAACCTACATGTCGGGAGGGCCGCCAGCCTTTCTCGGCGCCAGGTCT
TGGCTGCACAAGTTTGCCCACTTTCTTGTTGTGCAGAAAATATGCGACAAGGAAACTGTCGAAGTCATTTCGCGA
GCTCGCGTTCCGCTGGTCAAGTTTGTTGACACCTTGACTGGCCTCAGGGTCGACGTTTCCTTTGAGAACTTGGGC
GGCGTTCAGGCAATTGATACCTTTTTGCAATGGAAAACCGACTACCCCGCCATGCCAGCGCTTGTGACCGTGGTC
AAACACTTTCTGCTCATGCGTGGTCTTAATGAGCCGGTCAATGGCGGAATTGGAGGTTTCTCAGTCATTTGCCTC
GTTGTCAGCATGCTCCAAGTTCTGCCGCACATTCAAAGCCGCAGCGCTGCCAGCGCCCATCATTTGGGGGAGCTA
CTTCTCATCTTCTTTGAGCTCTATGGTCGCCATTTTCGGTACGACAAAGTTGCTATTTCCCTCAGGGATCCCATT
GGTTATGTGCGAAAGTCGGAAGTCTTGAGCTTGACATATCGCAACACGGATAGGCTGTCGATTATCGATCCCAAC
AATGCGTCAAACGACATTACGGGAGGCGCATCCAACACGGGCGCAATAATGGGTTGCTTCCACGATGCCTTTGTT
GCCCTGACTGATCGAATGCGAGAGGTGGCCCGGCAGCCGGGAAATGGCGGCATCCTCGACATCCTACTGGAAGGG
GATTACTCATCATTTCGAATGCAACGGCGATATCTGAAGCACGTTTACGAAGGCGTGTTTGGGCCCTGTCAGGAC
GAATGA
Gene >OphauG2|1281
ATGTCTAGACGCAACGAACCGCCCTCGCGGCGTGGCGATGATCTTTACGATAGCTGGCGTCCGCTCAGCAATCAG
CATAGCCACGATTCTTATCGAGCAGGACCAGACTCGCATCGCCCGTCCCACTCAAATCGGGCATATGAGTCGTAT
CGCCCCTCGGCTTCCTCTGCCCCCGAGTCTCGCAGCCGCTCCTACCAACACACCTACCAGCCACCCCAGCCTCCA
CAATCAGACTTTACCTTTCGTCTTGATTATCCTCACACAAGCTTCACTCCCATCAATCCCGGAGCAAAAAGGCCC
AGCCAAGCGCCCCGCAGGTCTGACCGTGACCGCCCTAGGCGCGTGCCTGCTTCCCAGAGCCGTCCTCGTTGGAAA
CCTCCCCATCCCTATGAGCGTGCCTTGATATCTGGCAACACTTCGGTGCAGCCCAGCGAGCGTCTCCACGAGAAC
GGTGCCAAGTTTCGCAACCCCGACGACCTGTCAGACGACAACGAGGTTGACATGGTCATATCTTCGTCTGAATCG
GCATCTGACAAGCCAGCCAAGAAGCGGGTGCGAATAGACGGCAACGTGGGTAATGACGATACTCCCAAGTGGTCC
AATCCTGATCCATATACGGCCCTTCCATGCCCTGACGAGACACGCCGCAAGAAGTCTGACGTGGTTCAACTGATT
CGCAAGGCGCGTGTTGAAGAAACTAAGCCAGCTGTTGAGACTGTCCCCGAGGCTGAAAACTTTTTGTCCTTTGAT
CTTTCGGCTAGCGAGGGCGAGACCAAAGAGGTGCTTCCCACCAGGAGCTCTCTCCCAGGCTCGCATTCACTGCCA
TCTAGTCTTCCGCCCCGCCCCCCAGTCCCTGAGGTACCCCCCCCTTCTGTGCCCACCGTCGACAGGCCACTAGCC
CCGGACCGCTCAGGTCCCCTGGGCTCACGCAAGCGCACTGCAGACGACGTGATCAAGCCTCCAGACTACGGCAAG
CTTAACAAGACCAACATGAAGCCCTCCAAGGGCAATCTGATGGCGCAGTGGGAGCCCAAGGCGGGCCAAGACTTG
TGCCCTTGGGTCTTGACAAACCATGCCAGTGAGACCAATATGGCGGTTCGGTAGGTTGCCATCCTTGCCAGTCTT
TGACACTCTTTTAGTTGCTTACTCCGCGACAGGCTACATAAAGAAATTGTGGATTTTTACGACTTTGTTCGGCCC
AAAAAGTTTGAGCAGTGCATTCGTGAAAACCTTGTCCAAAACCTGCAAAACGCTATGCGTCGCGACCCACGTTTC
TCGTCGGCCACGATGCACGCGTTTGGCTCCTACATGTCGGGCCTGTACCTGCCAACCGCTGACATGGACCTTGTC
GTTTGCTCGGCAACCTACATGTCGGGAGGGCCGCCAGCCTTTCTCGGCGCCAGGTCTTGGCTGCACAAGTTTGCC
CACTTTCTTGTTGTGCAGAAAATATGCGACAAGGAAACTGTCGAAGTCATTTCGCGAGCTCGCGTTCCGCTGGTC
AAGTTTGTTGACACCTTGACTGGCCTCAGGGTCGACGTTTCCTTTGAGAACTTGGGCGGCGTTCAGGCAATTGAT
ACCTTTTTGCAATGGAAAACCGACTACCCCGCCATGCCAGCGCTTGTGACCGTGGTCAAACACTTTCTGCTCATG
CGTGGTCTTAATGAGCCGGTCAATGGCGGAATTGGAGGTTTCTCAGTCATTTGCCTCGTTGTCAGCATGCTCCAA
GTTCTGCCGCACATTCAAAGCCGCAGCGCTGCCAGCGCCCATCATTTGGGGGAGCTACTTCTCATCTTCTTTGAG
CTCTATGGTCGCCATTTTCGGTACGACAAAGTTGCTATTTCCCTCAGGGATCCCATTGGTTATGTGCGAAAGGTA
AGAGATGGGTGTATCCGTCTTGGTTGTTGCCGCCTTGATGCTAATGCCATGTATAGTCGGAAGTCTTGAGCTTGA
CATATCGCAACACGGATAGGCTGTCGATTATCGATCCCAACAATGCGTCAAACGACATTACGGGAGGCGCATCCA
ACACGGGCGCAATAATGGGTTGCTTCCACGATGCCTTTGTTGCCCTGACTGATCGAATGCGAGAGGTGGCCCGGC
AGCCGGGAAATGGCGGCATCCTCGACATCCTACTGGAAGGGGATTACTCATCATTTCGAATGCAACGGCGATATC
TGAAGCACGTTTACGAAGGCGTGTTTGGGCCCTGTCAGGACGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail