Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1269
Gene name
LocationContig_1372:1431..2600
Strand+
Gene length (bp)1169
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 3.6E-19 158 285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 8 287 7.0E-54
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 25 285 1.0E-50
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 21 285 5.0E-42
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 20 285 3.0E-34
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 153 309 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 8 287 7.0E-54
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 25 285 1.0E-50
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 21 285 5.0E-42
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 20 285 3.0E-34
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 153 309 1.0E-15
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 153 309 1.0E-15
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 153 309 1.0E-15
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 164 310 3.0E-15
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 153 311 4.0E-15
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 153 286 5.0E-15
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 153 286 1.0E-14
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 164 310 3.0E-14
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 153 309 2.0E-13
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 158 313 2.0E-12
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 42 318 3.0E-12
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 120 314 7.0E-12
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 173 286 6.0E-11
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 155 286 2.0E-10
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 161 286 4.0E-09
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 151 286 6.0E-09
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 160 286 7.0E-09
sp|Q5PRC0|CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio GN=ch25h PE=2 SV=1 162 285 2.0E-08
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 155 313 4.0E-08
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 161 304 1.0E-07
sp|Q4QQV7|CH25H_RAT Cholesterol 25-hydroxylase OS=Rattus norvegicus GN=Ch25h PE=2 SV=1 144 285 7.0E-07
sp|Q4G1G8|CH25H_PIG Cholesterol 25-hydroxylase OS=Sus scrofa GN=CH25H PE=2 SV=1 160 285 7.0E-07
sp|Q9Z0F5|CH25H_MOUSE Cholesterol 25-hydroxylase OS=Mus musculus GN=Ch25h PE=1 SV=1 159 285 1.0E-06
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 162 285 2.0E-06
sp|Q9GKT2|FXDC2_MACFA Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis GN=FAXDC2 PE=2 SV=1 155 294 8.0E-06
sp|Q20027|C25HL_CAEEL Cholesterol 25-hydroxylase-like protein OS=Caenorhabditis elegans GN=F35C8.5 PE=1 SV=1 143 318 8.0E-06
sp|Q96IV6|FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1 155 294 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008610 lipid biosynthetic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0005506 iron ion binding Yes
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4739
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1269 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|157
Ophiocordyceps australis map64 (Brazil) OphauB2|2580
Ophiocordyceps australis map64 (Brazil) OphauB2|2582
Ophiocordyceps kimflemingae Ophio5|3398
Ophiocordyceps kimflemingae Ophio5|3400

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1269
MTDKQPVACGPCPRASLVPGVSDQTLSLAAPVVAHWLTSAFYEIIHRFGFFEKYRIHSSQEEGKKNVVGRLECLR
GVLTIQIMQTALGVAIGAFSQEDVAGPQDGDMLAWEGRVQGAGQVIDDLLSTCGLNVGLSCQVEVQRLVSKIIYH
CLIPVLRFFVALCLADTWVFFIHRAEHSNQWIYKMFHARHHELYVPYSWGGIYDHPIESLFLSVGAFVVAVMGTG
MTLRESIFFSVFSSIKTCTDHGGYRFPWNPIDVMTTIGADYHDVHHQRWGLKFWDRLFGTDFADTQTVARLYARD
RKAAEMGAENKEDKIKAS*
Coding >OphauG2|1269
ATGACTGACAAACAGCCTGTGGCTTGTGGGCCCTGCCCGAGAGCGTCGCTTGTCCCGGGAGTGTCCGACCAGACC
CTTTCCCTTGCTGCGCCTGTTGTGGCACACTGGCTCACGTCGGCCTTTTACGAAATCATTCACCGATTTGGCTTT
TTCGAAAAGTACAGGATTCATTCTAGCCAGGAAGAAGGCAAGAAGAATGTTGTTGGAAGACTCGAGTGTCTGCGC
GGCGTACTCACAATACAGATTATGCAAACTGCTCTGGGCGTCGCGATTGGTGCATTTTCCCAAGAGGACGTGGCG
GGTCCGCAAGATGGCGACATGCTGGCTTGGGAGGGCAGAGTACAAGGTGCTGGACAAGTCATTGACGATCTTCTC
TCGACTTGCGGCCTCAACGTCGGGCTGTCATGTCAAGTTGAAGTGCAGAGACTAGTCTCCAAGATTATCTACCAC
TGTCTCATTCCAGTGCTGCGCTTCTTCGTGGCGTTGTGTCTAGCAGATACCTGGGTCTTTTTCATCCATCGAGCA
GAGCACAGCAACCAGTGGATATATAAAATGTTCCACGCGCGCCATCACGAGCTCTATGTTCCGTATAGCTGGGGC
GGCATTTACGACCATCCCATCGAAAGCCTCTTCCTCAGCGTCGGCGCCTTTGTCGTTGCAGTCATGGGCACAGGC
ATGACGCTTCGGGAAAGCATCTTCTTCTCAGTCTTTTCCTCGATAAAGACGTGCACTGACCATGGAGGATATCGA
TTTCCGTGGAATCCGATAGACGTCATGACTACCATTGGTGCTGACTATCATGATGTGCACCACCAGCGATGGGGG
TTAAAGTTTTGGGACCGTCTTTTCGGAACAGACTTTGCGGATACGCAGACTGTAGCTAGGCTGTATGCTCGAGAT
CGAAAGGCTGCAGAAATGGGTGCGGAAAACAAGGAAGACAAGATCAAGGCATCCTAA
Transcript >OphauG2|1269
ATGACTGACAAACAGCCTGTGGCTTGTGGGCCCTGCCCGAGAGCGTCGCTTGTCCCGGGAGTGTCCGACCAGACC
CTTTCCCTTGCTGCGCCTGTTGTGGCACACTGGCTCACGTCGGCCTTTTACGAAATCATTCACCGATTTGGCTTT
TTCGAAAAGTACAGGATTCATTCTAGCCAGGAAGAAGGCAAGAAGAATGTTGTTGGAAGACTCGAGTGTCTGCGC
GGCGTACTCACAATACAGATTATGCAAACTGCTCTGGGCGTCGCGATTGGTGCATTTTCCCAAGAGGACGTGGCG
GGTCCGCAAGATGGCGACATGCTGGCTTGGGAGGGCAGAGTACAAGGTGCTGGACAAGTCATTGACGATCTTCTC
TCGACTTGCGGCCTCAACGTCGGGCTGTCATGTCAAGTTGAAGTGCAGAGACTAGTCTCCAAGATTATCTACCAC
TGTCTCATTCCAGTGCTGCGCTTCTTCGTGGCGTTGTGTCTAGCAGATACCTGGGTCTTTTTCATCCATCGAGCA
GAGCACAGCAACCAGTGGATATATAAAATGTTCCACGCGCGCCATCACGAGCTCTATGTTCCGTATAGCTGGGGC
GGCATTTACGACCATCCCATCGAAAGCCTCTTCCTCAGCGTCGGCGCCTTTGTCGTTGCAGTCATGGGCACAGGC
ATGACGCTTCGGGAAAGCATCTTCTTCTCAGTCTTTTCCTCGATAAAGACGTGCACTGACCATGGAGGATATCGA
TTTCCGTGGAATCCGATAGACGTCATGACTACCATTGGTGCTGACTATCATGATGTGCACCACCAGCGATGGGGG
TTAAAGTTTTGGGACCGTCTTTTCGGAACAGACTTTGCGGATACGCAGACTGTAGCTAGGCTGTATGCTCGAGAT
CGAAAGGCTGCAGAAATGGGTGCGGAAAACAAGGAAGACAAGATCAAGGCATCCTAA
Gene >OphauG2|1269
ATGACTGACAAACAGCCTGTGGCTTGTGGGCCCTGCCCGAGAGCGTCGCTTGTCCCGGGAGTGTCCGACCAGACC
CTTTCCCTTGCTGCGCCTGTTGTGGCACACTGGCTCACGTCGGCCTTTTACGAAATCATTCACCGATTTGGCTTT
TTCGAAAAGTACAGGATTCATTCTAGCCAGGAAGAAGGCAAGAAGAATGTTGTTGGAAGACTCGAGTGTCTGCGC
GGCGTACTCACAATACAGGTGTGATGATGTTTGTTTCTAGCTGCTTCTTGAATATATTTTGACCTTGGTGTTTTA
GATTATGCAAACTGCTCTGGGCGTCGCGATTGGTGCATTTTCCCAAGAGGACGTGGCGGGTCCGCAAGATGGCGA
CATGCTGGCTTGGGAGGGCAGAGTACAAGGTGCTGGACAAGTCATTGACGATCTTCTCTCGACTTGCGGCCTCAA
CGTCGGGCTGTCATGTCAAGTTGAAGTGCAGAGACTAGTCTCCAAGATTATCTACCACTGTCTCATTCCAGTGCT
GCGCTTCTTCGTGGCGTTGTGTCTAGCAGATACCTGGGTCTTTTTCATCCATCGAGCAGAGCACAGCAACCAGTG
GATATATAGTAAGACTAACCGCCTATCCTGAATCCAATAAAGCCAACCTAACGCGCCGTCTAGAAATGTTCCACG
CGCGCCATCACGAGCTCTATGTTCCGTATAGCTGGGGCGGCATTTACGACCATCCCATCGAAAGCCTCTTCCTCA
GCGTCGGCGCCTTTGTCGTTGCAGTCATGGGCACAGGCATGACGCTTCGGGAAAGCATCTTCTTCTCAGTCTTTT
CCTCGATAAAGACGTGCACTGACCATGGAGGATATCGATTTCCGTGGAATCCGATAGACGTCATGACTACCATTG
GTGCTGACTATCATGATGTGCACCACCAGCGATGGGGGTTAAAGGTGAGTTGTTTTCTTTGGCGCCTCTTTTTTT
ATTGGGAGCTGACTATTGTTAATGACGCGGGGGACAAAAAAAAGACAAACTTTGCTCTTCATTTTCAGTTTTGGG
ACCGTCTTTTCGGAACAGACTTTGCGGATACGCAGACTGTAGCTAGGCTGTATGCTCGAGATCGAAAGGCTGCAG
AAATGGGTGCGGAAAACAAGGAAGACAAGATCAAGGCATCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail