Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1256
Gene name
LocationContig_137:2021..3903
Strand-
Gene length (bp)1882
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 3.9E-14 227 291
PF17123 zf-RING_11 RING-like zinc finger 2.5E-13 356 384
PF13639 zf-RING_2 Ring finger domain 5.8E-07 356 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38823|DMA1_YEAST E3 ubiquitin-protein ligase DMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA1 PE=1 SV=1 135 411 1.0E-66
sp|A6ZRW7|DMA2_YEAS7 E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DMA2 PE=3 SV=1 175 409 2.0E-66
sp|P53924|DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA2 PE=1 SV=1 175 409 2.0E-66
sp|Q10322|DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dma1 PE=1 SV=1 175 421 8.0E-57
sp|O74388|YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.13 PE=1 SV=1 198 311 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38823|DMA1_YEAST E3 ubiquitin-protein ligase DMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA1 PE=1 SV=1 135 411 1.0E-66
sp|A6ZRW7|DMA2_YEAS7 E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DMA2 PE=3 SV=1 175 409 2.0E-66
sp|P53924|DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA2 PE=1 SV=1 175 409 2.0E-66
sp|Q10322|DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dma1 PE=1 SV=1 175 421 8.0E-57
sp|O74388|YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.13 PE=1 SV=1 198 311 7.0E-14
sp|Q14BN4|SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens GN=SLMAP PE=1 SV=1 207 294 1.0E-08
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS=Oryctolagus cuniculus GN=SLMAP PE=1 SV=2 226 294 1.0E-08
sp|Q3URD3|SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus GN=Slmap PE=1 SV=2 207 294 7.0E-08
sp|P0C219|SLMAP_RAT Sarcolemmal membrane-associated protein OS=Rattus norvegicus GN=Slmap PE=1 SV=1 207 294 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5082
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1256 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|760
Ophiocordyceps camponoti-floridani Ophcf2|05993
Ophiocordyceps camponoti-rufipedis Ophun1|135
Ophiocordyceps kimflemingae Ophio5|5683
Ophiocordyceps subramaniannii Hirsu2|2971

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1256
MFTQPFASPPPGPSTALPSRPSRLRGLSYLRNYTHNHLLSRDSRPPLDASAGQPHRPANQSSASSASSASSTRSS
AAASPPTAAGLARSVSCSLAPTSAMHTPGSRLTLIGTSVVLPPLAADLEPKPDTTGPHSPQPADQHQHMAATMAG
PRTEPPASDSPAAAPLPSDASPPSSIRFSSYFDPRSSRPSLLFPPVSRTLPSGSETIRVGRYSERDGLANAPANQ
PSAAPVGFKSKVVSRRHCEFWCEDGKWYIKDVKSSSGTFLNHIRLSPPSQESRAYQVNDGDIVQLGIDFKGGEEM
IFRCVKMRIELNRGWQNKLNVFNVAAHKRLWKIAAGGASSSAISGSNSTAGSNSQDCSICLNSIAPCQSLFVAPC
SHTWHFKCIRSLLLSPQYSIFICPNCRASADLEADVDEPEEEWQQLDQGQHDMQEAPEEAVNEAAVPRRPSSEPI
GDGTPDADVLDQTMISAPSDSASNVSTNSHAATDPLPIDNPSSGSGRAAHLRDEQCPSPSCNGEGPITPRNNAGP
WVFDGGAGTRAVDSQIPEMRSLDAAADLHINRQESSDDSV*
Coding >OphauG2|1256
ATGTTTACCCAACCGTTTGCGTCGCCGCCGCCAGGGCCCTCGACTGCCCTTCCATCTCGCCCCAGCCGACTGCGC
GGGCTCAGCTATCTCCGAAACTATACACACAACCACCTCTTGTCGCGCGATAGTCGGCCGCCGCTGGATGCTTCT
GCTGGACAGCCGCACCGGCCCGCCAACCAGTCGTCGGCTTCGTCGGCTTCGTCGGCGTCATCAACAAGGTCGTCT
GCCGCCGCGTCGCCGCCAACGGCTGCGGGTCTGGCTCGCTCCGTCAGCTGCTCCCTTGCCCCGACGTCGGCGATG
CACACGCCGGGCAGCAGACTGACCCTTATTGGCACCAGCGTCGTACTTCCGCCTCTGGCCGCCGACCTGGAGCCC
AAGCCGGACACAACCGGCCCCCACTCGCCCCAGCCGGCTGACCAGCATCAGCACATGGCTGCCACCATGGCCGGC
CCCAGGACCGAGCCGCCCGCTTCCGACTCCCCTGCCGCCGCCCCGTTGCCGAGTGACGCGTCGCCGCCCTCGTCG
ATTCGCTTCTCGTCCTACTTTGACCCGCGCTCGTCGCGTCCCTCTCTCCTCTTCCCTCCCGTGTCGCGCACCCTC
CCCTCGGGCTCCGAGACCATTCGCGTCGGCCGCTACTCTGAGCGCGACGGCCTGGCCAATGCCCCGGCTAACCAG
CCCTCGGCCGCCCCGGTCGGCTTCAAGAGCAAGGTGGTCAGCCGTCGCCACTGCGAGTTTTGGTGCGAGGACGGC
AAGTGGTACATCAAGGACGTCAAAAGCTCGTCGGGCACCTTTCTCAACCACATCCGCCTCAGCCCCCCTTCCCAG
GAGAGCAGGGCCTACCAGGTCAACGACGGCGACATTGTCCAGCTCGGCATCGACTTCAAGGGCGGCGAAGAAATG
ATCTTCCGCTGCGTCAAGATGCGCATCGAGCTCAACCGCGGCTGGCAAAACAAGCTCAACGTCTTCAATGTCGCT
GCTCACAAACGGCTGTGGAAGATTGCCGCCGGCGGGGCATCGTCATCCGCTATTTCAGGTTCCAATTCCACAGCG
GGCTCCAATTCCCAAGACTGCTCCATCTGCCTCAACTCCATCGCGCCGTGCCAGTCTCTCTTTGTCGCCCCCTGC
TCTCACACCTGGCACTTCAAGTGCATCCGATCCCTGCTTCTCTCCCCCCAATACTCCATCTTCATTTGTCCCAAT
TGCCGGGCAAGTGCCGATCTCGAGGCCGATGTAGACGAGCCCGAGGAGGAATGGCAGCAGCTCGACCAGGGCCAA
CATGACATGCAAGAGGCGCCAGAAGAAGCAGTCAACGAGGCCGCAGTTCCGCGTCGGCCAAGCTCGGAGCCCATT
GGTGACGGGACTCCGGATGCCGATGTCTTGGATCAGACCATGATTTCGGCACCTTCGGATAGCGCGTCGAATGTG
TCGACCAATTCCCATGCCGCTACGGATCCACTGCCTATTGATAATCCGTCGTCTGGTTCTGGTCGGGCAGCCCAT
CTCAGAGACGAGCAGTGCCCGTCTCCCAGCTGCAACGGCGAAGGTCCCATCACGCCTAGGAATAATGCAGGGCCT
TGGGTCTTTGATGGAGGAGCAGGGACTCGCGCGGTAGACAGCCAGATTCCCGAGATGCGGAGCCTCGACGCGGCA
GCAGATTTGCACATTAACCGCCAAGAATCAAGCGATGATTCTGTATAG
Transcript >OphauG2|1256
ATGTTTACCCAACCGTTTGCGTCGCCGCCGCCAGGGCCCTCGACTGCCCTTCCATCTCGCCCCAGCCGACTGCGC
GGGCTCAGCTATCTCCGAAACTATACACACAACCACCTCTTGTCGCGCGATAGTCGGCCGCCGCTGGATGCTTCT
GCTGGACAGCCGCACCGGCCCGCCAACCAGTCGTCGGCTTCGTCGGCTTCGTCGGCGTCATCAACAAGGTCGTCT
GCCGCCGCGTCGCCGCCAACGGCTGCGGGTCTGGCTCGCTCCGTCAGCTGCTCCCTTGCCCCGACGTCGGCGATG
CACACGCCGGGCAGCAGACTGACCCTTATTGGCACCAGCGTCGTACTTCCGCCTCTGGCCGCCGACCTGGAGCCC
AAGCCGGACACAACCGGCCCCCACTCGCCCCAGCCGGCTGACCAGCATCAGCACATGGCTGCCACCATGGCCGGC
CCCAGGACCGAGCCGCCCGCTTCCGACTCCCCTGCCGCCGCCCCGTTGCCGAGTGACGCGTCGCCGCCCTCGTCG
ATTCGCTTCTCGTCCTACTTTGACCCGCGCTCGTCGCGTCCCTCTCTCCTCTTCCCTCCCGTGTCGCGCACCCTC
CCCTCGGGCTCCGAGACCATTCGCGTCGGCCGCTACTCTGAGCGCGACGGCCTGGCCAATGCCCCGGCTAACCAG
CCCTCGGCCGCCCCGGTCGGCTTCAAGAGCAAGGTGGTCAGCCGTCGCCACTGCGAGTTTTGGTGCGAGGACGGC
AAGTGGTACATCAAGGACGTCAAAAGCTCGTCGGGCACCTTTCTCAACCACATCCGCCTCAGCCCCCCTTCCCAG
GAGAGCAGGGCCTACCAGGTCAACGACGGCGACATTGTCCAGCTCGGCATCGACTTCAAGGGCGGCGAAGAAATG
ATCTTCCGCTGCGTCAAGATGCGCATCGAGCTCAACCGCGGCTGGCAAAACAAGCTCAACGTCTTCAATGTCGCT
GCTCACAAACGGCTGTGGAAGATTGCCGCCGGCGGGGCATCGTCATCCGCTATTTCAGGTTCCAATTCCACAGCG
GGCTCCAATTCCCAAGACTGCTCCATCTGCCTCAACTCCATCGCGCCGTGCCAGTCTCTCTTTGTCGCCCCCTGC
TCTCACACCTGGCACTTCAAGTGCATCCGATCCCTGCTTCTCTCCCCCCAATACTCCATCTTCATTTGTCCCAAT
TGCCGGGCAAGTGCCGATCTCGAGGCCGATGTAGACGAGCCCGAGGAGGAATGGCAGCAGCTCGACCAGGGCCAA
CATGACATGCAAGAGGCGCCAGAAGAAGCAGTCAACGAGGCCGCAGTTCCGCGTCGGCCAAGCTCGGAGCCCATT
GGTGACGGGACTCCGGATGCCGATGTCTTGGATCAGACCATGATTTCGGCACCTTCGGATAGCGCGTCGAATGTG
TCGACCAATTCCCATGCCGCTACGGATCCACTGCCTATTGATAATCCGTCGTCTGGTTCTGGTCGGGCAGCCCAT
CTCAGAGACGAGCAGTGCCCGTCTCCCAGCTGCAACGGCGAAGGTCCCATCACGCCTAGGAATAATGCAGGGCCT
TGGGTCTTTGATGGAGGAGCAGGGACTCGCGCGGTAGACAGCCAGATTCCCGAGATGCGGAGCCTCGACGCGGCA
GCAGATTTGCACATTAACCGCCAAGAATCAAGCGATGATTCTGTATAG
Gene >OphauG2|1256
ATGTTTACCCAACCGTTTGCGTCGCCGCCGCCAGGGCCCTCGACTGCCCTTCCATCTCGCCCCAGCCGACTGCGC
GGGCTCAGCTATCTCCGAAACTATACACACAACCACCTCTTGTCGCGCGATAGTCGGCCGCCGCTGGATGCTTCT
GCTGGACAGCCGCACCGGCCCGCCAACCAGTCGTCGGCTTCGTCGGCTTCGTCGGCGTCATCAACAAGGTCGTCT
GCCGCCGCGTCGCCGCCAACGGCTGCGGGTCTGGCTCGCTCCGTCAGCTGCTCCCTTGCCCCGACGTCGGCGATG
CACACGCCGGGCAGCAGACTGACCCTTATTGGCACCAGCGTCGTACTTCCGCCTCTGGCCGCCGACCTGGAGCCC
AAGCCGGACACAACCGGCCCCCACTCGCCCCAGCCGGCTGACCAGCATCAGCACATGGCTGCCACCATGGCCGGC
CCCAGGACCGAGCCGCCCGCTTCCGACTCCCCTGCCGCCGCCCCGTTGCCGAGTGACGCGTCGCCGCCCTCGTCG
ATTCGCTTCTCGTCCTACTTTGACCCGCGCTCGTCGCGTCCCTCTCTCCTCTTCCCTCCCGTGTCGCGCACCCTC
CCCTCGGGCTCCGAGACCATTCGCGTCGGCCGCTACTCTGAGCGCGACGGCCTGGCCAATGCCCCGGCTAACCAG
CCCTCGGCCGCCCCGGTCGGCTTCAAGAGCAAGGTGGTCAGCCGTCGCCACTGCGAGTTTTGGTGCGAGGACGGC
AAGTGGTACATCAAGGACGTCAAAAGCTCGTCGGGCACCTTTCTCAACCACATCCGCCTCAGCCCCCCTTCCCAG
GAGAGCAGGGCCTACCAGGTCAACGACGGCGACATTGTCCAGCTCGGCATCGACTTCAAGGGCGGCGAAGAAATG
ATCTTCCGCTGCGTCAAGATGCGCATCGAGCTCAACCGCGGCTGGCAAAACAAGCTCAACGTCTTCAAGTATGTC
TGCGCCCTCTCTGCTCTTGCTCCAATAGGCCTTTATTGCCTCCACAATATTGGCTGTGCTAGCCACCTCCTGCTG
ACATGTCTTACCCTCGCCCAGTGTCGCTGCTCACAAACGGCTGTGGAAGATTGCCGCCGGCGGGGCATCGTCATC
CGCTATTTCAGGTTCCAATTCCACAGCGGGCTCCAATTCCCAAGACTGCTCCATCTGCCTCAACTCCATCGCGGT
TGGTCAAGCCCGCTCCCTGCTTTCCAGCTGACACTTCCCCCCCTCCACCCGGCACACGCACGCTAACTTTGTCAC
TCAGCCGTGCCAGTCTCTCTTTGTCGCCCCCTGCTCTCACACCTGGCACTTCAAGTGCATCCGATCCCTGCTTCT
CTCCCCCCAATACTCCATCTTCATTTGTCCCAATTGCCGGGCAAGTGCCGATCTCGAGGCCGATGTAGACGAGCC
CGAGGAGGAATGGCAGCAGCTCGACCAGGGCCAACATGACATGCAAGAGGCGCCAGAAGAAGCAGTCAACGAGGC
CGCAGTTCCGCGTCGGCCAAGCTCGGAGCCCATTGGTGACGGGACTCCGGATGCCGATGTCTTGGATCAGACCAT
GATTTCGGCACCTTCGGATAGCGCGTCGAATGTGTCGACCAATTCCCATGCCGCTACGGATCCACTGCCTATTGA
TAATCCGTCGTCTGGTTCTGGTCGGGCAGCCCATCTCAGAGACGAGCAGTGCCCGTCTCCCAGCTGCAACGGCGA
AGGTCCCATCACGCCTAGGAATAATGCAGGGCCTTGGGTCTTTGATGGAGGAGCAGGGACTCGCGCGGTAGACAG
CCAGATTCCCGAGATGCGGAGCCTCGACGCGGCAGCAGATTTGCACATTAACCGCCAAGAATCAAGCGATGATTC
TGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail