Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1254
Gene name
LocationContig_1368:738..1839
Strand+
Gene length (bp)1101
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07039 DUF1325 SGF29 tudor-like domain 1.8E-35 234 364

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USW9|SGF29_SCHPO SAGA-associated factor 29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf29 PE=1 SV=2 230 364 1.0E-17
sp|P25554|SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF29 PE=1 SV=2 235 362 5.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5646
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1254 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7565
Ophiocordyceps camponoti-rufipedis Ophun1|6961
Ophiocordyceps kimflemingae Ophio5|4266
Ophiocordyceps subramaniannii Hirsu2|795

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1254
MAHRNRSGRGSSRNNGGNSQHGEEAQIWEACKAQIAEIVTSINAENDNLSQIVNLDKKIGAVDPEKVATDLFRHL
EDRSRAGVKFSETNMMLLKSVIEQLNVLRAVVLAKEQAEGTGHGAGPSGSGNTGGPSKRSTRDKGDGGAAAAAAA
AALYDFEGAGDSPVPSPMAGGSAGRKHGDRASSTRDRDSMPPKADSVEPQGSIAGGSGGSGPGSAVSTSGAAANG
GNRRVVFSKGDTVAFKPKNSGGEATSDWILGEVAAVLGEGKSRRYKVLDVEPDEEPGKQKEYRTSASSMIAIAPE
SAAGTLKAWEAGKLVLALYPQTTTFYRAEVHSMDEGGRMVNLKFEGENDSTTLQQVERRFVIEYRQ*
Coding >OphauG2|1254
ATGGCCCATCGCAACCGCAGCGGCCGGGGATCAAGCCGCAACAATGGTGGCAATTCACAACACGGCGAAGAAGCA
CAAATCTGGGAAGCATGCAAGGCGCAAATCGCCGAAATCGTGACTAGCATCAACGCAGAGAACGACAACCTTTCA
CAAATCGTCAACCTGGACAAGAAGATTGGGGCCGTGGATCCGGAAAAGGTGGCGACGGATCTGTTTCGCCATCTC
GAGGATCGGTCCCGTGCAGGCGTCAAGTTTTCCGAGACCAACATGATGCTGCTCAAGTCGGTCATTGAGCAACTC
AATGTCTTGCGCGCCGTGGTGCTGGCAAAAGAACAAGCCGAGGGCACAGGACATGGCGCTGGCCCTTCTGGATCT
GGAAACACGGGTGGTCCGAGCAAGCGCTCAACCAGAGACAAGGGCGACGGGGGGGCAGCGGCGGCAGCGGCGGCA
GCGGCCTTGTACGACTTTGAAGGAGCCGGAGACTCTCCTGTGCCAAGCCCAATGGCTGGCGGCTCGGCTGGCAGG
AAGCACGGCGACCGGGCGTCTAGCACGCGCGACCGAGATAGCATGCCGCCCAAGGCAGACAGCGTGGAACCACAA
GGCTCAATCGCCGGCGGCTCTGGTGGCTCGGGCCCCGGCTCGGCAGTATCCACATCGGGCGCAGCAGCCAACGGC
GGCAATCGGCGCGTCGTCTTCAGCAAAGGCGACACAGTGGCCTTTAAACCCAAAAACTCGGGCGGCGAGGCTACG
TCGGACTGGATCTTGGGAGAGGTGGCAGCTGTGCTGGGCGAAGGCAAGAGTCGGAGATATAAGGTACTCGATGTT
GAGCCAGACGAGGAGCCAGGGAAGCAAAAAGAATATCGTACAAGTGCAAGCAGTATGATTGCCATTGCCCCCGAG
AGCGCAGCCGGGACGCTCAAGGCTTGGGAGGCGGGCAAGTTGGTGCTGGCGCTCTATCCCCAAACGACGACATTC
TACAGAGCCGAGGTGCACAGCATGGACGAGGGGGGGCGAATGGTCAATCTCAAGTTTGAAGGAGAAAACGACTCG
ACAACATTGCAGCAGGTTGAGCGGCGGTTTGTCATTGAATACAGGCAATGA
Transcript >OphauG2|1254
ATGGCCCATCGCAACCGCAGCGGCCGGGGATCAAGCCGCAACAATGGTGGCAATTCACAACACGGCGAAGAAGCA
CAAATCTGGGAAGCATGCAAGGCGCAAATCGCCGAAATCGTGACTAGCATCAACGCAGAGAACGACAACCTTTCA
CAAATCGTCAACCTGGACAAGAAGATTGGGGCCGTGGATCCGGAAAAGGTGGCGACGGATCTGTTTCGCCATCTC
GAGGATCGGTCCCGTGCAGGCGTCAAGTTTTCCGAGACCAACATGATGCTGCTCAAGTCGGTCATTGAGCAACTC
AATGTCTTGCGCGCCGTGGTGCTGGCAAAAGAACAAGCCGAGGGCACAGGACATGGCGCTGGCCCTTCTGGATCT
GGAAACACGGGTGGTCCGAGCAAGCGCTCAACCAGAGACAAGGGCGACGGGGGGGCAGCGGCGGCAGCGGCGGCA
GCGGCCTTGTACGACTTTGAAGGAGCCGGAGACTCTCCTGTGCCAAGCCCAATGGCTGGCGGCTCGGCTGGCAGG
AAGCACGGCGACCGGGCGTCTAGCACGCGCGACCGAGATAGCATGCCGCCCAAGGCAGACAGCGTGGAACCACAA
GGCTCAATCGCCGGCGGCTCTGGTGGCTCGGGCCCCGGCTCGGCAGTATCCACATCGGGCGCAGCAGCCAACGGC
GGCAATCGGCGCGTCGTCTTCAGCAAAGGCGACACAGTGGCCTTTAAACCCAAAAACTCGGGCGGCGAGGCTACG
TCGGACTGGATCTTGGGAGAGGTGGCAGCTGTGCTGGGCGAAGGCAAGAGTCGGAGATATAAGGTACTCGATGTT
GAGCCAGACGAGGAGCCAGGGAAGCAAAAAGAATATCGTACAAGTGCAAGCAGTATGATTGCCATTGCCCCCGAG
AGCGCAGCCGGGACGCTCAAGGCTTGGGAGGCGGGCAAGTTGGTGCTGGCGCTCTATCCCCAAACGACGACATTC
TACAGAGCCGAGGTGCACAGCATGGACGAGGGGGGGCGAATGGTCAATCTCAAGTTTGAAGGAGAAAACGACTCG
ACAACATTGCAGCAGGTTGAGCGGCGGTTTGTCATTGAATACAGGCAATGA
Gene >OphauG2|1254
ATGGCCCATCGCAACCGCAGCGGCCGGGGATCAAGCCGCAACAATGGTGGCAATTCACAACACGGCGAAGAAGCA
CAAATCTGGGAAGCATGCAAGGCGCAAATCGCCGAAATCGTGACTAGCATCAACGCAGAGAACGACAACCTTTCA
CAAATCGTCAACCTGGACAAGAAGATTGGGGCCGTGGATCCGGAAAAGGTGGCGACGGATCTGTTTCGCCATCTC
GAGGATCGGTCCCGTGCAGGCGTCAAGTTTTCCGAGACCAACATGATGCTGCTCAAGTCGGTCATTGAGCAACTC
AATGTCTTGCGCGCCGTGGTGCTGGCAAAAGAACAAGCCGAGGGCACAGGACATGGCGCTGGCCCTTCTGGATCT
GGAAACACGGGTGGTCCGAGCAAGCGCTCAACCAGAGACAAGGGCGACGGGGGGGCAGCGGCGGCAGCGGCGGCA
GCGGCCTTGTACGACTTTGAAGGAGCCGGAGACTCTCCTGTGCCAAGCCCAATGGCTGGCGGCTCGGCTGGCAGG
AAGCACGGCGACCGGGCGTCTAGCACGCGCGACCGAGATAGCATGCCGCCCAAGGCAGACAGCGTGGAACCACAA
GGCTCAATCGCCGGCGGCTCTGGTGGCTCGGGCCCCGGCTCGGCAGTATCCACATCGGGCGCAGCAGCCAACGGC
GGCAATCGGCGCGTCGTCTTCAGCAAAGGCGACACAGTGGCCTTTAAACCCAAAAACTCGGGCGGCGAGGCTACG
TCGGACTGGATCTTGGGAGAGGTGGCAGCTGTGCTGGGCGAAGGCAAGAGTCGGAGATATAAGGTACTCGATGTT
GAGCCAGACGAGGAGCCAGGGAAGCAAAAAGAATATCGTACAAGTGCAAGCAGTATGATTGCCATTGCCCCCGAG
AGCGCAGCCGGGACGCTCAAGGCTTGGGAGGCGGGCAAGTTGGTGCTGGCGCTCTATCCCCAAACGACGACATTC
TACAGAGCCGAGGTGCACAGCATGGACGAGGGGGGGCGAATGGTCAATCTCAAGTTTGAAGGAGAAAACGACTCG
ACAACATTGCAGCAGGTTGAGCGGCGGTTTGTCATTGAATACAGGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail