Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1224
Gene name
LocationContig_1351:87..1633
Strand-
Gene length (bp)1546
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13393 tRNA-synt_His Histidyl-tRNA synthetase 2.4E-36 22 356
PF03129 HGTP_anticodon Anticodon binding domain 4.0E-08 376 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43011|SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hts1 PE=1 SV=2 8 478 0.0E+00
sp|P07263|SYH_YEAST Histidine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTS1 PE=1 SV=2 2 478 2.0E-178
sp|Q61035|SYHC_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Hars PE=1 SV=2 15 476 1.0E-158
sp|P70076|SYHC_TAKRU Histidine--tRNA ligase, cytoplasmic OS=Takifugu rubripes GN=hars PE=3 SV=1 8 476 1.0E-158
sp|P12081|SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2 11 476 1.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43011|SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hts1 PE=1 SV=2 8 478 0.0E+00
sp|P07263|SYH_YEAST Histidine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTS1 PE=1 SV=2 2 478 2.0E-178
sp|Q61035|SYHC_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Hars PE=1 SV=2 15 476 1.0E-158
sp|P70076|SYHC_TAKRU Histidine--tRNA ligase, cytoplasmic OS=Takifugu rubripes GN=hars PE=3 SV=1 8 476 1.0E-158
sp|P12081|SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2 11 476 1.0E-157
sp|Q2KI84|SYHC_BOVIN Histidine--tRNA ligase, cytoplasmic OS=Bos taurus GN=HARS PE=2 SV=1 15 476 1.0E-157
sp|Q5R4R2|SYHC_PONAB Histidine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=HARS PE=2 SV=1 11 476 6.0E-157
sp|Q86AS6|SYHC_DICDI Histidine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=hisS PE=3 SV=1 15 450 4.0E-153
sp|Q5R5E5|SYHM_PONAB Probable histidine--tRNA ligase, mitochondrial OS=Pongo abelii GN=HARS2 PE=2 SV=1 7 447 1.0E-147
sp|P49590|SYHM_HUMAN Probable histidine--tRNA ligase, mitochondrial OS=Homo sapiens GN=HARS2 PE=1 SV=1 7 447 3.0E-147
sp|A5D7V9|SYHM_BOVIN Probable histidine--tRNA ligase, mitochondrial OS=Bos taurus GN=HARS2 PE=2 SV=1 7 447 3.0E-147
sp|P07178|SYHC_MESAU Histidine--tRNA ligase, cytoplasmic OS=Mesocricetus auratus GN=HARS PE=2 SV=1 11 476 1.0E-140
sp|Q99KK9|SYHM_MOUSE Probable histidine--tRNA ligase, mitochondrial OS=Mus musculus GN=Hars2 PE=1 SV=1 1 447 7.0E-140
sp|P93422|SYHC_ORYSJ Histidine--tRNA ligase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os05g0150900 PE=2 SV=2 18 461 3.0E-134
sp|F4IYF8|SYHC_ARATH Histidine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g02760 PE=2 SV=1 18 478 6.0E-132
sp|P34183|SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans GN=hrs-1 PE=2 SV=3 13 478 4.0E-129
sp|Q6E6B4|SYHC_ANTLO Probable histidine--tRNA ligase, cytoplasmic OS=Antonospora locustae PE=3 SV=1 15 456 1.0E-102
sp|Q8SRR3|SYHC_ENCCU Probable histidine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0620 PE=3 SV=1 16 446 4.0E-100
sp|C4V9J0|SYHC_NOSCE Probable histidine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_101238 PE=3 SV=1 15 450 6.0E-97
sp|Q8A6N7|SYH_BACTN Histidine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisS PE=3 SV=1 20 470 2.0E-78
sp|Q64QS2|SYH_BACFR Histidine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=hisS PE=3 SV=1 20 455 7.0E-76
sp|Q5LAE0|SYH_BACFN Histidine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisS PE=3 SV=1 20 455 8.0E-75
sp|A6KXA6|SYH_BACV8 Histidine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=hisS PE=3 SV=1 20 475 9.0E-74
sp|Q7MTB3|SYH_PORGI Histidine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=hisS PE=3 SV=1 20 466 4.0E-71
sp|A6LIF7|SYH_PARD8 Histidine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=hisS PE=3 SV=1 20 453 5.0E-71
sp|P62367|SYH1_BACC1 Histidine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisS1 PE=3 SV=1 15 454 7.0E-69
sp|Q81B71|SYH1_BACCR Histidine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisS-1 PE=3 SV=1 15 454 6.0E-68
sp|Q6HG86|SYH1_BACHK Histidine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisS1 PE=3 SV=1 15 454 7.0E-68
sp|Q7NHH9|SYH_GLOVI Histidine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisS PE=3 SV=1 17 450 7.0E-68
sp|Q81N41|SYH1_BACAN Histidine--tRNA ligase 1 OS=Bacillus anthracis GN=hisS-1 PE=3 SV=1 15 454 5.0E-67
sp|Q7UZ20|SYH_RHOBA Histidine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisS PE=3 SV=1 18 449 1.0E-65
sp|Q638Q6|SYH1_BACCZ Histidine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=hisS1 PE=3 SV=1 15 454 1.0E-64
sp|A0M0E2|SYH_GRAFK Histidine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=hisS PE=3 SV=1 20 456 5.0E-64
sp|B6YS23|SYH_AZOPC Histidine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=hisS PE=3 SV=1 17 447 5.0E-64
sp|A5F9R5|SYH_FLAJ1 Histidine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hisS PE=3 SV=1 20 456 4.0E-60
sp|Q9YEB2|SYH_AERPE Histidine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hisS PE=3 SV=2 18 357 3.0E-57
sp|Q11RN9|SYH_CYTH3 Histidine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisS PE=3 SV=1 20 453 9.0E-57
sp|Q892X7|SYH_CLOTE Histidine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=hisS PE=3 SV=1 30 456 1.0E-56
sp|Q5WCR7|SYH2_BACSK Histidine--tRNA ligase 2 OS=Bacillus clausii (strain KSM-K16) GN=hisS2 PE=3 SV=1 21 455 6.0E-55
sp|Q7M8S6|SYH_WOLSU Histidine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisS PE=3 SV=1 15 455 1.0E-54
sp|Q8YMC2|SYH_NOSS1 Histidine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisS PE=1 SV=1 10 478 1.0E-53
sp|B2J5J5|SYH_NOSP7 Histidine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hisS PE=3 SV=1 15 478 6.0E-52
sp|Q7VF68|SYH_HELHP Histidine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisS PE=3 SV=1 15 452 2.0E-51
sp|Q3MAV8|SYH_ANAVT Histidine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisS PE=3 SV=1 10 478 4.0E-51
sp|B1L6B4|SYH_KORCO Histidine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=hisS PE=3 SV=1 17 356 6.0E-51
sp|B2UUV2|SYH_HELPS Histidine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=hisS PE=3 SV=1 15 452 5.0E-49
sp|P56455|SYH_HELPY Histidine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hisS PE=3 SV=1 15 452 6.0E-49
sp|P60920|SYH_TREDE Histidine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=hisS PE=3 SV=1 18 437 7.0E-49
sp|Q1CS74|SYH_HELPH Histidine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=hisS PE=3 SV=1 15 452 8.0E-49
sp|Q17VP5|SYH_HELAH Histidine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=hisS PE=3 SV=1 15 452 2.0E-48
sp|Q3IWD2|SYH_RHOS4 Histidine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisS PE=3 SV=1 7 452 5.0E-48
sp|B9KU51|SYH_RHOSK Histidine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisS PE=3 SV=1 7 452 6.0E-48
sp|Q9ZK27|SYH_HELPJ Histidine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hisS PE=3 SV=1 15 452 8.0E-48
sp|B5Z8I6|SYH_HELPG Histidine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=hisS PE=3 SV=1 15 452 1.0E-47
sp|B2FPL6|SYH_STRMK Histidine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=hisS PE=3 SV=1 18 447 4.0E-47
sp|B6JN30|SYH_HELP2 Histidine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=hisS PE=3 SV=1 15 452 2.0E-46
sp|A8LKA5|SYH_DINSH Histidine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisS PE=3 SV=1 18 478 7.0E-46
sp|Q9A2P3|SYH_CAUCR Histidine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisS PE=3 SV=1 18 478 8.0E-46
sp|Q28TV0|SYH_JANSC Histidine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=hisS PE=3 SV=1 18 478 8.0E-46
sp|B4STN3|SYH_STRM5 Histidine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hisS PE=3 SV=1 18 447 9.0E-46
sp|Q87C26|SYH_XYLFT Histidine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisS PE=3 SV=1 18 478 1.0E-45
sp|B2I5Y4|SYH_XYLF2 Histidine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=hisS PE=3 SV=1 18 478 1.0E-45
sp|Q3BUG0|SYH_XANC5 Histidine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisS PE=3 SV=1 18 449 2.0E-45
sp|Q4UU37|SYH_XANC8 Histidine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hisS PE=3 SV=1 18 447 2.0E-45
sp|Q8P9P5|SYH_XANCP Histidine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisS PE=3 SV=1 18 447 4.0E-45
sp|A1B3C5|SYH_PARDP Histidine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisS PE=3 SV=1 18 478 5.0E-45
sp|Q8PLH2|SYH_XANAC Histidine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisS PE=3 SV=1 18 447 5.0E-45
sp|Q1GJD0|SYH_RUEST Histidine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=hisS PE=3 SV=1 19 452 7.0E-45
sp|Q5H0L6|SYH_XANOR Histidine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hisS PE=3 SV=2 18 468 2.0E-44
sp|B2SKP3|SYH_XANOP Histidine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hisS PE=3 SV=1 18 468 2.0E-44
sp|Q9PBC2|SYH_XYLFA Histidine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=hisS PE=3 SV=1 18 478 2.0E-44
sp|Q2P3K8|SYH_XANOM Histidine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisS PE=3 SV=1 18 468 3.0E-44
sp|Q47RX0|SYH_THEFY Histidine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=hisS PE=3 SV=1 45 360 3.0E-44
sp|B0U3B6|SYH_XYLFM Histidine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=hisS PE=3 SV=1 18 478 4.0E-44
sp|B3QII5|SYH_RHOPT Histidine--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisS PE=3 SV=1 1 461 4.0E-44
sp|Q0SP28|SYH_BORAP Histidine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=hisS PE=3 SV=1 15 356 5.0E-44
sp|Q5LVN3|SYH_RUEPO Histidine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisS PE=3 SV=1 18 478 3.0E-43
sp|B0S168|SYH_FINM2 Histidine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=hisS PE=3 SV=1 19 475 4.0E-43
sp|B7J168|SYH_BORBZ Histidine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=hisS PE=3 SV=1 15 356 1.0E-42
sp|O51160|SYH_BORBU Histidine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=hisS PE=3 SV=2 15 356 1.0E-42
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 31 449 4.0E-42
sp|Q662M6|SYH_BORBP Histidine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=hisS PE=3 SV=1 15 356 2.0E-41
sp|P60919|SYH_RHOPA Histidine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisS PE=3 SV=1 1 461 2.0E-41
sp|Q97FJ7|SYH_CLOAB Histidine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisS PE=3 SV=1 30 455 2.0E-41
sp|B9J9Y1|SYH_AGRRK Histidine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=hisS PE=3 SV=1 15 458 2.0E-40
sp|A1RUZ2|SYH_PYRIL Histidine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=hisS PE=3 SV=1 18 454 4.0E-40
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 31 456 5.0E-40
sp|Q160T4|SYH_ROSDO Histidine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisS PE=3 SV=1 18 449 5.0E-39
sp|B1YCS2|SYH_PYRNV Histidine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=hisS PE=3 SV=1 18 454 2.0E-38
sp|B2S3N0|SYH_TREPS Histidine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=hisS PE=3 SV=1 13 361 4.0E-38
sp|O83647|SYH_TREPA Histidine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=hisS PE=3 SV=1 13 361 4.0E-38
sp|Q92RR7|SYH_RHIME Histidine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=hisS PE=3 SV=1 15 458 4.0E-38
sp|Q5JIM2|SYH_THEKO Histidine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisS PE=3 SV=1 21 462 4.0E-37
sp|Q4FND9|SYH_PELUB Histidine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=hisS PE=3 SV=1 20 449 4.0E-37
sp|Q8UHK4|SYH_AGRFC Histidine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisS PE=3 SV=1 1 458 3.0E-36
sp|B5ZRD0|SYH_RHILW Histidine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=hisS PE=3 SV=1 15 458 4.0E-36
sp|Q1MKY0|SYH_RHIL3 Histidine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=hisS PE=3 SV=1 15 458 1.0E-35
sp|Q21AX3|SYH_RHOPB Histidine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisS PE=3 SV=1 1 478 2.0E-35
sp|A4G0V7|SYH_METM5 Histidine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisS PE=3 SV=1 15 470 4.0E-35
sp|Q6FYU5|SYH_BARQU Histidine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=hisS PE=3 SV=1 1 479 4.0E-35
sp|Q89DI2|SYH_BRADU Histidine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisS PE=3 SV=1 1 452 4.0E-35
sp|A9A947|SYH_METM6 Histidine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisS PE=3 SV=1 15 453 7.0E-35
sp|Q987T0|SYH_RHILO Histidine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=hisS PE=3 SV=1 1 478 2.0E-34
sp|P60921|SYH_METMP Histidine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisS PE=3 SV=1 17 453 2.0E-34
sp|P60922|SYH_NANEQ Histidine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=hisS PE=3 SV=1 20 354 2.0E-34
sp|O58028|SYH_PYRHO Histidine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hisS PE=3 SV=1 21 478 2.0E-34
sp|A6VHK3|SYH_METM7 Histidine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisS PE=3 SV=1 15 453 3.0E-34
sp|Q8ZWZ1|SYH_PYRAE Histidine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hisS PE=3 SV=1 17 382 9.0E-34
sp|Q9UY31|SYH_PYRAB Histidine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hisS PE=3 SV=1 21 478 1.0E-33
sp|A1UTY3|SYH_BARBK Histidine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=hisS PE=3 SV=1 17 479 2.0E-33
sp|B8ER30|SYH_METSB Histidine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hisS PE=3 SV=1 16 362 2.0E-33
sp|Q58406|SYH_METJA Histidine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisS PE=3 SV=1 15 356 2.0E-33
sp|A4WIN2|SYH_PYRAR Histidine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=hisS PE=3 SV=1 17 382 3.0E-33
sp|Q8U431|SYH_PYRFU Histidine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisS PE=3 SV=1 21 478 3.0E-33
sp|O82413|SYHM_ARATH Histidine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=At3g46100 PE=2 SV=1 20 453 5.0E-33
sp|A6UT01|SYH_META3 Histidine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisS PE=3 SV=1 20 356 5.0E-33
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 33 446 9.0E-33
sp|A6UQQ6|SYH_METVS Histidine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisS PE=3 SV=1 17 453 2.0E-32
sp|Q8YB45|SYH_BRUME Histidine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisS PE=3 SV=1 1 458 8.0E-32
sp|C0RKC7|SYH_BRUMB Histidine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisS PE=3 SV=1 1 458 8.0E-32
sp|Q8FX93|SYH_BRUSU Histidine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=hisS PE=3 SV=1 1 458 9.0E-32
sp|A9MDU4|SYH_BRUC2 Histidine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisS PE=3 SV=1 1 458 9.0E-32
sp|A5VTT4|SYH_BRUO2 Histidine--tRNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisS PE=3 SV=1 1 458 1.0E-31
sp|Q579Q8|SYH_BRUAB Histidine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisS PE=3 SV=1 1 458 1.0E-31
sp|Q2YIH9|SYH_BRUA2 Histidine--tRNA ligase OS=Brucella abortus (strain 2308) GN=hisS PE=3 SV=1 1 458 1.0E-31
sp|B2SCY7|SYH_BRUA1 Histidine--tRNA ligase OS=Brucella abortus (strain S19) GN=hisS PE=3 SV=1 1 458 1.0E-31
sp|A9WXP3|SYH_BRUSI Histidine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisS PE=3 SV=1 1 458 2.0E-31
sp|Q9QZ05|E2AK4_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Mus musculus GN=Eif2ak4 PE=1 SV=2 37 410 2.0E-31
sp|O26346|SYH_METTH Histidine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisS PE=3 SV=2 15 460 3.0E-31
sp|Q6A8J7|SYH_PROAC Histidine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisS PE=3 SV=1 17 426 6.0E-31
sp|A3MTI8|SYH_PYRCJ Histidine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hisS PE=3 SV=1 17 356 1.0E-30
sp|C5CCH4|SYH_MICLC Histidine--tRNA ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hisS PE=3 SV=1 21 456 9.0E-30
sp|B0SQQ4|SYH_LEPBP Histidine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisS PE=3 SV=1 15 447 1.0E-29
sp|B0SH39|SYH_LEPBA Histidine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisS PE=3 SV=1 15 447 1.0E-29
sp|B7GPS9|SYH_BIFLS Histidine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=hisS PE=3 SV=1 21 426 1.0E-29
sp|Q8F9Y3|SYH_LEPIN Histidine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisS PE=3 SV=1 12 456 6.0E-29
sp|P62371|SYH_LEPIC Histidine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisS PE=3 SV=1 12 456 1.0E-28
sp|Q8G864|SYH_BIFLO Histidine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=hisS PE=3 SV=1 21 426 2.0E-28
sp|Q8CWW2|SYH_STRMU Histidine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisS PE=3 SV=1 15 447 2.0E-28
sp|Q5UXW4|SYH_HALMA Histidine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisS PE=3 SV=1 21 383 4.0E-28
sp|Q3IMP5|SYH_NATPD Histidine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisS PE=3 SV=1 21 383 4.0E-28
sp|Q6G289|SYH_BARHE Histidine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=hisS PE=3 SV=1 1 458 8.0E-28
sp|Q04X87|SYH_LEPBL Histidine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hisS PE=3 SV=1 12 456 9.0E-28
sp|Q04WC4|SYH_LEPBJ Histidine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hisS PE=3 SV=1 12 456 9.0E-28
sp|Q8DN46|SYH_STRR6 Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hisS PE=3 SV=1 15 478 1.0E-27
sp|B8ZPP6|SYH_STRPJ Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=hisS PE=3 SV=1 15 478 1.0E-27
sp|Q04I50|SYH_STRP2 Histidine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=hisS PE=3 SV=1 15 478 1.0E-27
sp|A4VT07|SYH_STRSY Histidine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=hisS PE=3 SV=1 15 447 2.0E-27
sp|A4VZ92|SYH_STRS2 Histidine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=hisS PE=3 SV=1 15 447 2.0E-27
sp|Q975U9|SYH_SULTO Histidine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisS PE=3 SV=1 21 450 2.0E-27
sp|B8DU04|SYH_BIFA0 Histidine--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=hisS PE=3 SV=1 21 426 2.0E-27
sp|C1CU26|SYH_STRZT Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=hisS PE=3 SV=1 15 478 3.0E-27
sp|C1CH52|SYH_STRZJ Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=hisS PE=3 SV=1 15 478 3.0E-27
sp|B2IN41|SYH_STRPS Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=hisS PE=3 SV=1 15 478 3.0E-27
sp|Q980L3|SYH_SULSO Histidine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisS PE=3 SV=1 17 449 4.0E-27
sp|B5E3C8|SYH_STRP4 Histidine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=hisS PE=3 SV=1 15 478 8.0E-27
sp|Q9HLX5|SYH_THEAC Histidine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hisS PE=1 SV=1 15 456 8.0E-27
sp|A2RGY1|SYH_STRPG Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=hisS PE=3 SV=1 15 447 1.0E-26
sp|Q8NZ19|SYH_STRP8 Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hisS PE=3 SV=1 15 447 1.0E-26
sp|Q97NC9|SYH_STRPN Histidine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hisS PE=3 SV=1 15 478 1.0E-26
sp|B5XJ83|SYH_STRPZ Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=hisS PE=3 SV=1 15 447 1.0E-26
sp|Q99XK9|SYH_STRP1 Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=hisS PE=3 SV=1 15 447 1.0E-26
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 33 410 1.0E-26
sp|C1CNA0|SYH_STRZP Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=hisS PE=3 SV=1 15 478 1.0E-26
sp|Q5X9E5|SYH_STRP6 Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hisS PE=3 SV=2 15 447 2.0E-26
sp|B1I9T7|SYH_STRPI Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=hisS PE=3 SV=1 15 478 2.0E-26
sp|Q9KDG2|SYH_BACHD Histidine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisS PE=3 SV=1 15 476 3.0E-26
sp|Q48QS7|SYH_STRPM Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=hisS PE=3 SV=2 15 447 4.0E-26
sp|C1CAV1|SYH_STRP7 Histidine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=hisS PE=3 SV=1 15 478 4.0E-26
sp|P0DG41|SYH_STRPQ Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hisS PE=3 SV=1 15 447 4.0E-26
sp|P0DG40|SYH_STRP3 Histidine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hisS PE=3 SV=1 15 447 4.0E-26
sp|B3CLR6|SYH_WOLPP Histidine--tRNA ligase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=hisS PE=3 SV=1 15 461 5.0E-26
sp|C3MY40|SYH_SULIM Histidine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hisS PE=3 SV=1 17 449 6.0E-26
sp|C3MRE4|SYH_SULIL Histidine--tRNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hisS PE=3 SV=1 17 449 6.0E-26
sp|C4KIQ9|SYH_SULIK Histidine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hisS PE=3 SV=1 17 449 6.0E-26
sp|C3N7K1|SYH_SULIY Histidine--tRNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hisS PE=3 SV=1 17 449 8.0E-26
sp|Q9CE78|SYH_LACLA Histidine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisS PE=3 SV=1 15 447 1.0E-25
sp|C3NFX3|SYH_SULIN Histidine--tRNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hisS PE=3 SV=1 17 449 2.0E-25
sp|Q83FF5|SYH_TROWT Probable histidine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=hisS PE=3 SV=1 20 361 2.0E-25
sp|Q83H72|SYH_TROW8 Probable histidine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=hisS PE=3 SV=1 20 361 2.0E-25
sp|A2RN96|SYH_LACLM Histidine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisS PE=3 SV=1 15 447 8.0E-25
sp|Q8EWB8|SYH_MYCPE Histidine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=hisS PE=3 SV=1 15 478 1.0E-24
sp|Q817X7|SYH2_BACCR Histidine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisS-2 PE=3 SV=1 15 479 1.0E-24
sp|P62370|SYH2_BACC1 Histidine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisS2 PE=3 SV=1 15 479 1.0E-24
sp|B1I363|SYH_DESAP Histidine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=hisS PE=3 SV=1 15 452 1.0E-24
sp|A3CR40|SYH_STRSV Histidine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=hisS PE=3 SV=1 15 447 1.0E-24
sp|Q5FUR8|SYH_GLUOX Histidine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=hisS PE=3 SV=1 17 450 1.0E-24
sp|Q6HDC2|SYH2_BACHK Histidine--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisS2 PE=3 SV=1 15 479 2.0E-24
sp|Q634E2|SYH2_BACCZ Histidine--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=hisS2 PE=3 SV=1 15 479 2.0E-24
sp|Q81LI6|SYH2_BACAN Histidine--tRNA ligase 2 OS=Bacillus anthracis GN=hisS-2 PE=3 SV=1 15 479 2.0E-24
sp|Q8Y029|SYH_RALSO Histidine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=hisS PE=3 SV=1 21 459 2.0E-24
sp|A4IR95|SYH_GEOTN Histidine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisS PE=3 SV=1 15 453 3.0E-24
sp|B7IHK5|SYH_THEAB Histidine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=hisS PE=3 SV=1 18 460 4.0E-24
sp|A6LL06|SYH_THEM4 Histidine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=hisS PE=3 SV=1 18 460 5.0E-24
sp|Q6ADR4|SYH_LEIXX Histidine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisS PE=3 SV=1 14 361 6.0E-24
sp|Q18DQ2|SYH_HALWD Histidine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisS PE=3 SV=1 21 383 8.0E-24
sp|P60916|SYH_LACJO Histidine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=hisS PE=3 SV=1 15 452 9.0E-24
sp|Q02WI8|SYH_LACLS Histidine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisS PE=3 SV=1 15 447 1.0E-23
sp|Q2RHW0|SYH_MOOTA Histidine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisS PE=3 SV=1 20 455 1.0E-23
sp|Q043X4|SYH_LACGA Histidine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=hisS PE=3 SV=1 15 452 1.0E-23
sp|C3LT13|SYH_VIBCM Histidine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisS PE=3 SV=1 14 456 1.0E-23
sp|Q9KTX0|SYH_VIBCH Histidine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisS PE=3 SV=1 14 456 1.0E-23
sp|A5F3G1|SYH_VIBC3 Histidine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisS PE=3 SV=1 14 456 1.0E-23
sp|Q8EPR9|SYH_OCEIH Histidine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisS PE=3 SV=1 15 453 2.0E-23
sp|Q87S15|SYH_VIBPA Histidine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisS PE=3 SV=1 14 456 2.0E-23
sp|Q04AV4|SYH_LACDB Histidine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=hisS PE=3 SV=1 15 466 2.0E-23
sp|C5D510|SYH_GEOSW Histidine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=hisS PE=3 SV=1 15 453 3.0E-23
sp|C0R4G6|SYH_WOLWR Histidine--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=hisS PE=3 SV=1 15 460 3.0E-23
sp|C4XT36|SYH_DESMR Histidine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=hisS PE=3 SV=1 21 466 3.0E-23
sp|A5I6D6|SYH_CLOBH Histidine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisS PE=3 SV=1 15 452 3.0E-23
sp|A7FY04|SYH_CLOB1 Histidine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisS PE=3 SV=1 15 452 3.0E-23
sp|Q1GAG8|SYH_LACDA Histidine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=hisS PE=3 SV=1 15 466 4.0E-23
sp|A8MGM7|SYH_ALKOO Histidine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hisS PE=3 SV=1 20 464 4.0E-23
sp|B1L097|SYH_CLOBM Histidine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=hisS PE=3 SV=1 15 452 4.0E-23
sp|B1IMD8|SYH_CLOBK Histidine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=hisS PE=3 SV=1 15 452 4.0E-23
sp|Q03IB2|SYH_STRTD Histidine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=hisS PE=3 SV=1 15 447 4.0E-23
sp|A7GHS3|SYH_CLOBL Histidine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisS PE=3 SV=1 15 452 4.0E-23
sp|A8AZV0|SYH_STRGC Histidine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hisS PE=3 SV=1 15 447 5.0E-23
sp|B8D110|HISZ_HALOH ATP phosphoribosyltransferase regulatory subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=hisZ PE=3 SV=1 17 356 5.0E-23
sp|B4U0K6|SYH_STREM Histidine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=hisS PE=3 SV=1 15 447 8.0E-23
sp|Q65GR3|SYH_BACLD Histidine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisS PE=3 SV=1 55 475 8.0E-23
sp|Q5M281|SYH_STRT2 Histidine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=hisS PE=3 SV=1 15 447 8.0E-23
sp|Q5LXM9|SYH_STRT1 Histidine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=hisS PE=3 SV=1 15 447 8.0E-23
sp|C1FKE6|SYH_CLOBJ Histidine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisS PE=3 SV=1 15 452 9.0E-23
sp|Q8TV61|SYH_METKA Histidine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisS PE=3 SV=1 15 357 9.0E-23
sp|Q5KWS8|SYH_GEOKA Histidine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=hisS PE=3 SV=1 15 456 1.0E-22
sp|B1ZUW6|SYH_OPITP Histidine--tRNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=hisS PE=3 SV=1 16 450 1.0E-22
sp|Q2JRX6|SYH_SYNJA Histidine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisS PE=3 SV=1 17 456 1.0E-22
sp|C3KTB7|SYH_CLOB6 Histidine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisS PE=3 SV=1 15 452 1.0E-22
sp|B8JBF6|SYH_ANAD2 Histidine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=hisS PE=3 SV=1 21 474 2.0E-22
sp|Q97CE6|SYH_THEVO Histidine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hisS PE=3 SV=1 15 476 2.0E-22
sp|B4UEL3|SYH_ANASK Histidine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=hisS PE=3 SV=1 21 474 2.0E-22
sp|A7GT85|SYH_BACCN Histidine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisS PE=3 SV=1 15 479 2.0E-22
sp|P56194|SYH_THET8 Histidine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisS PE=1 SV=2 15 454 2.0E-22
sp|P62374|SYH_THET2 Histidine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisS PE=1 SV=1 15 454 2.0E-22
sp|Q7MNF0|SYH_VIBVY Histidine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=hisS PE=3 SV=1 14 453 2.0E-22
sp|Q8DEZ9|SYH_VIBVU Histidine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=hisS PE=3 SV=2 14 453 2.0E-22
sp|B4EZT2|SYH_PROMH Histidine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=hisS PE=3 SV=1 14 478 2.0E-22
sp|A3QCG3|SYH_SHELP Histidine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=hisS PE=3 SV=1 5 478 4.0E-22
sp|A5IN85|SYH_THEP1 Histidine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=hisS PE=3 SV=1 15 476 4.0E-22
sp|A7MZE2|SYH_VIBCB Histidine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hisS PE=3 SV=1 17 456 5.0E-22
sp|A8YUZ9|SYH_LACH4 Histidine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=hisS PE=3 SV=1 15 452 7.0E-22
sp|C3MZH9|SYH_SULIA Histidine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=hisS PE=3 SV=1 17 449 7.0E-22
sp|C0MGD4|SYH_STRS7 Histidine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=hisS PE=3 SV=1 15 447 8.0E-22
sp|A7I940|SYH_METB6 Histidine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=hisS PE=3 SV=1 17 456 9.0E-22
sp|A5FX98|SYH_ACICJ Histidine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=hisS PE=3 SV=1 21 466 9.0E-22
sp|P67486|SYH_STRA5 Histidine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=hisS PE=3 SV=1 15 447 9.0E-22
sp|P67485|SYH_STRA3 Histidine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=hisS PE=3 SV=1 15 447 9.0E-22
sp|B9LRS2|SYH_HALLT Histidine--tRNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=hisS PE=3 SV=1 21 352 1.0E-21
sp|B2A2F9|SYH_NATTJ Histidine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hisS PE=3 SV=1 18 383 1.0E-21
sp|P30053|SYH_STREQ Histidine--tRNA ligase OS=Streptococcus dysgalactiae subsp. equisimilis GN=hisS PE=1 SV=2 15 447 2.0E-21
sp|Q8RGJ5|SYH_FUSNN Histidine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hisS PE=3 SV=1 17 447 2.0E-21
sp|Q8TS62|SYH_METAC Histidine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisS PE=3 SV=1 15 474 2.0E-21
sp|Q3JYL6|SYH_STRA1 Histidine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=hisS PE=3 SV=1 15 447 2.0E-21
sp|Q3A5R6|SYH_PELCD Histidine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisS PE=3 SV=1 44 455 3.0E-21
sp|B8CKR2|SYH_SHEPW Histidine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=hisS PE=3 SV=1 5 478 3.0E-21
sp|P62351|SYH_WOLPM Histidine--tRNA ligase OS=Wolbachia pipientis wMel GN=hisS PE=3 SV=1 15 455 4.0E-21
sp|Q3AA16|SYH_CARHZ Histidine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisS PE=3 SV=1 18 460 4.0E-21
sp|Q5FG57|SYH_EHRRG Histidine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=hisS PE=3 SV=1 17 456 4.0E-21
sp|Q9HNP5|SYH_HALSA Histidine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisS PE=3 SV=1 21 456 5.0E-21
sp|B0R6V2|SYH_HALS3 Histidine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisS PE=3 SV=1 21 456 5.0E-21
sp|A6WQP6|SYH_SHEB8 Histidine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=hisS PE=3 SV=1 5 449 5.0E-21
sp|A3D6V8|SYH_SHEB5 Histidine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=hisS PE=3 SV=1 5 449 5.0E-21
sp|B8E9S8|SYH_SHEB2 Histidine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=hisS PE=3 SV=1 5 449 5.0E-21
sp|A1RHQ4|SYH_SHESW Histidine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=hisS PE=3 SV=1 5 467 5.0E-21
sp|A4Y8T9|SYH_SHEPC Histidine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=hisS PE=3 SV=1 5 467 5.0E-21
sp|O28631|SYH_ARCFU Histidine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisS PE=3 SV=1 15 450 5.0E-21
sp|B1L829|SYH_THESQ Histidine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=hisS PE=3 SV=1 21 476 5.0E-21
sp|A9KXK7|SYH_SHEB9 Histidine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=hisS PE=3 SV=1 5 449 5.0E-21
sp|O32039|SYH_BACSU Histidine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=hisS PE=3 SV=1 20 453 6.0E-21
sp|Q5GSM4|SYH_WOLTR Histidine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=hisS PE=3 SV=1 15 479 6.0E-21
sp|A4YJ03|SYH_METS5 Histidine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hisS PE=3 SV=1 21 449 6.0E-21
sp|Q12PT3|SYH_SHEDO Histidine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hisS PE=3 SV=1 5 478 6.0E-21
sp|Q8PVB0|SYH_METMA Histidine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisS PE=3 SV=1 15 359 7.0E-21
sp|A9HJ49|SYH_GLUDA Histidine--tRNA ligase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisS PE=3 SV=1 16 453 7.0E-21
sp|A2C182|SYH_PROM1 Histidine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=hisS PE=3 SV=1 9 478 7.0E-21
sp|A8H246|SYH_SHEPA Histidine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hisS PE=3 SV=1 5 478 8.0E-21
sp|Q5HAI0|SYH_EHRRW Histidine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=hisS PE=3 SV=1 17 456 8.0E-21
sp|Q5FKI5|SYH_LACAC Histidine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=hisS PE=3 SV=1 15 452 8.0E-21
sp|Q9X0H5|SYH_THEMA Histidine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisS PE=3 SV=1 21 476 8.0E-21
sp|B9DW81|SYH_STRU0 Histidine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=hisS PE=3 SV=1 15 478 9.0E-21
sp|B7GFR0|SYH_ANOFW Histidine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisS PE=3 SV=1 15 478 9.0E-21
sp|A5D3E2|SYH_PELTS Histidine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisS PE=3 SV=1 20 460 9.0E-21
sp|A5CWE8|SYH_VESOH Histidine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisS PE=3 SV=1 5 456 9.0E-21
sp|A4J2J1|SYH_DESRM Histidine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=hisS PE=3 SV=1 20 455 1.0E-20
sp|B0TLI5|SYH_SHEHH Histidine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=hisS PE=3 SV=1 5 478 1.0E-20
sp|A7Z751|SYH_BACMF Histidine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisS PE=3 SV=1 15 475 1.0E-20
sp|Q3YRB1|SYH_EHRCJ Histidine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=hisS PE=3 SV=1 17 459 2.0E-20
sp|A1S862|SYH_SHEAM Histidine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=hisS PE=3 SV=1 5 478 2.0E-20
sp|A0PZW9|SYH_CLONN Histidine--tRNA ligase OS=Clostridium novyi (strain NT) GN=hisS PE=3 SV=1 15 476 2.0E-20
sp|Q8RAI8|SYH_CALS4 Histidine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisS PE=3 SV=1 18 454 2.0E-20
sp|C4K1W2|SYH_RICPU Histidine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=hisS PE=3 SV=1 17 454 2.0E-20
sp|P62373|SYH_PHOPR Histidine--tRNA ligase OS=Photobacterium profundum GN=hisS PE=3 SV=1 14 460 3.0E-20
sp|A8FT71|SYH_SHESH Histidine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=hisS PE=3 SV=1 5 478 3.0E-20
sp|B3EB83|SYH_GEOLS Histidine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hisS PE=3 SV=1 15 455 3.0E-20
sp|B5RCZ1|SYH_SALG2 Histidine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hisS PE=3 SV=1 14 478 4.0E-20
sp|Q8EC33|SYH_SHEON Histidine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=hisS PE=3 SV=1 5 467 4.0E-20
sp|B0K0N4|SYH_THEPX Histidine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=hisS PE=3 SV=1 18 477 4.0E-20
sp|Q7N705|SYH_PHOLL Histidine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisS PE=3 SV=1 14 456 5.0E-20
sp|Q5PBP9|SYH_ANAMM Histidine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=hisS PE=3 SV=1 17 452 5.0E-20
sp|A8GHW4|SYH_SERP5 Histidine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=hisS PE=3 SV=1 14 456 5.0E-20
sp|A8F593|SYH_PSELT Histidine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=hisS PE=3 SV=1 21 449 6.0E-20
sp|B9KHM7|SYH_ANAMF Histidine--tRNA ligase OS=Anaplasma marginale (strain Florida) GN=hisS PE=3 SV=1 17 452 6.0E-20
sp|B3QZS0|SYH_PHYMT Histidine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=hisS PE=3 SV=1 15 455 6.0E-20
sp|Q9KXP2|SYH_STRCO Histidine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisS PE=3 SV=1 16 456 6.0E-20
sp|Q2GLK4|SYH_ANAPZ Histidine--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=hisS PE=3 SV=1 21 478 7.0E-20
sp|B7VJT9|SYH_VIBTL Histidine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=hisS PE=3 SV=1 14 478 7.0E-20
sp|Q2GHH1|SYH_EHRCR Histidine--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=hisS PE=3 SV=1 17 455 8.0E-20
sp|Q5WHP4|SYH1_BACSK Histidine--tRNA ligase 1 OS=Bacillus clausii (strain KSM-K16) GN=hisS1 PE=3 SV=1 15 453 1.0E-19
sp|Q1WTV0|SYH_LACS1 Histidine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=hisS PE=3 SV=1 15 456 1.0E-19
sp|B2VE90|SYH_ERWT9 Histidine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hisS PE=3 SV=1 14 456 1.0E-19
sp|B5BAY6|SYH_SALPK Histidine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=hisS PE=3 SV=1 14 478 1.0E-19
sp|Q5PNI1|SYH_SALPA Histidine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisS PE=3 SV=1 14 478 1.0E-19
sp|Q57LI7|SYH_SALCH Histidine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=hisS PE=3 SV=1 14 478 1.0E-19
sp|B8GDZ3|SYH_METPE Histidine--tRNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=hisS PE=3 SV=1 17 452 1.0E-19
sp|Q67KH4|HISZ_SYMTH ATP phosphoribosyltransferase regulatory subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisZ PE=3 SV=1 18 386 1.0E-19
sp|C0MB21|SYH_STRE4 Histidine--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=hisS PE=3 SV=1 15 447 1.0E-19
sp|A7ZDK1|SYH_CAMC1 Histidine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=hisS PE=3 SV=1 21 474 2.0E-19
sp|B4TD92|SYH_SALHS Histidine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=hisS PE=3 SV=1 14 478 2.0E-19
sp|Q46LS5|SYH_PROMT Histidine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=hisS PE=3 SV=1 45 478 2.0E-19
sp|Q8Z4P4|SYH_SALTI Histidine--tRNA ligase OS=Salmonella typhi GN=hisS PE=3 SV=3 14 478 2.0E-19
sp|Q88VQ7|SYH_LACPL Histidine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisS PE=3 SV=1 20 478 2.0E-19
sp|B5FAX3|SYH_VIBFM Histidine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=hisS PE=3 SV=1 14 453 2.0E-19
sp|Q5E771|SYH_VIBF1 Histidine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hisS PE=3 SV=1 14 453 2.0E-19
sp|B8CXE6|SYH_HALOH Histidine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=hisS PE=3 SV=1 15 478 2.0E-19
sp|A7FFZ0|SYH_YERP3 Histidine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hisS PE=3 SV=1 14 456 2.0E-19
sp|A1ANS7|SYH_PELPD Histidine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=hisS PE=3 SV=1 44 452 2.0E-19
sp|Q92IK8|SYH_RICCN Histidine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hisS PE=3 SV=2 17 454 2.0E-19
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 28 409 3.0E-19
sp|B0TF88|SYH_HELMI Histidine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hisS PE=3 SV=1 15 455 3.0E-19
sp|Q0IDK4|SYH_SYNS3 Histidine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=hisS PE=3 SV=1 20 455 3.0E-19
sp|B0K977|SYH_THEP3 Histidine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisS PE=3 SV=1 18 477 3.0E-19
sp|Q1RJ50|SYH_RICBR Histidine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=hisS PE=3 SV=1 17 454 3.0E-19
sp|A8GVU9|SYH_RICB8 Histidine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=hisS PE=3 SV=1 17 454 3.0E-19
sp|Q0HX56|SYH_SHESR Histidine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=hisS PE=3 SV=1 5 467 3.0E-19
sp|O52765|SYH_SALTY Histidine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisS PE=1 SV=4 14 478 3.0E-19
sp|C0PYN1|SYH_SALPC Histidine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=hisS PE=3 SV=1 14 478 3.0E-19
sp|A9N202|SYH_SALPB Histidine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hisS PE=3 SV=1 14 478 3.0E-19
sp|B4T0P8|SYH_SALNS Histidine--tRNA ligase OS=Salmonella newport (strain SL254) GN=hisS PE=3 SV=1 14 478 3.0E-19
sp|B5R581|SYH_SALEP Histidine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=hisS PE=3 SV=1 14 478 3.0E-19
sp|B5FR62|SYH_SALDC Histidine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=hisS PE=3 SV=1 14 478 3.0E-19
sp|Q92BJ3|SYH_LISIN Histidine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisS PE=3 SV=1 15 456 4.0E-19
sp|Q0HKV8|SYH_SHESM Histidine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=hisS PE=3 SV=1 5 467 4.0E-19
sp|Q085U5|SYH_SHEFN Histidine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=hisS PE=3 SV=1 5 478 4.0E-19
sp|A9AGZ7|SYH_BURM1 Histidine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisS PE=3 SV=1 21 472 4.0E-19
sp|B4TR94|SYH_SALSV Histidine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=hisS PE=3 SV=1 14 478 4.0E-19
sp|B5F197|SYH_SALA4 Histidine--tRNA ligase OS=Salmonella agona (strain SL483) GN=hisS PE=3 SV=1 14 478 4.0E-19
sp|B6I586|SYH_ECOSE Histidine--tRNA ligase OS=Escherichia coli (strain SE11) GN=hisS PE=3 SV=1 14 478 4.0E-19
sp|Q24US1|SYH_DESHY Histidine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=hisS PE=3 SV=1 15 453 4.0E-19
sp|B8FQR7|SYH_DESHD Histidine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisS PE=3 SV=1 15 453 4.0E-19
sp|Q183H5|SYH_PEPD6 Histidine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=hisS PE=3 SV=1 18 478 5.0E-19
sp|A9MHL6|SYH_SALAR Histidine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hisS PE=3 SV=1 14 478 5.0E-19
sp|Q4JAY2|SYH_SULAC Histidine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hisS PE=3 SV=1 21 355 5.0E-19
sp|B7N6A2|SYH_ECOLU Histidine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hisS PE=3 SV=1 14 478 6.0E-19
sp|B1JS06|SYH_YERPY Histidine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|Q668A0|SYH_YERPS Histidine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|A4TMT6|SYH_YERPP Histidine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|Q1CK90|SYH_YERPN Histidine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|A9R801|SYH_YERPG Histidine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|Q8ZCT6|SYH_YERPE Histidine--tRNA ligase OS=Yersinia pestis GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|B2K9P9|SYH_YERPB Histidine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|Q1C5I9|SYH_YERPA Histidine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hisS PE=3 SV=1 14 456 7.0E-19
sp|Q6AQS3|SYH_DESPS Histidine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisS PE=3 SV=1 13 471 7.0E-19
sp|A8EZE6|SYH_RICCK Histidine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=hisS PE=3 SV=1 17 447 7.0E-19
sp|A0RPD3|SYH_CAMFF Histidine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisS PE=3 SV=1 21 455 8.0E-19
sp|Q1AX12|HISZ_RUBXD ATP phosphoribosyltransferase regulatory subunit OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=hisZ PE=3 SV=1 11 364 9.0E-19
sp|Q3ZWB6|SYH_DEHMC Histidine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisS PE=3 SV=1 18 476 1.0E-18
sp|A5FSR7|SYH_DEHMB Histidine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisS PE=3 SV=1 18 476 1.0E-18
sp|B3WEM3|SYH_LACCB Histidine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=hisS PE=3 SV=1 15 456 1.0E-18
sp|Q038S0|SYH_LACC3 Histidine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=hisS PE=3 SV=1 15 456 1.0E-18
sp|Q3YZ38|SYH_SHISS Histidine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B1XJ88|SYH_SYNP2 Histidine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=hisS PE=3 SV=1 16 450 1.0E-18
sp|B7LCQ4|SYH_ECO55 Histidine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|Q1R8L9|SYH_ECOUT Histidine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B1LNG9|SYH_ECOSM Histidine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|P60906|SYH_ECOLI Histidine--tRNA ligase OS=Escherichia coli (strain K12) GN=hisS PE=1 SV=2 14 478 1.0E-18
sp|B1IWE7|SYH_ECOLC Histidine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|P60907|SYH_ECOL6 Histidine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisS PE=3 SV=2 14 478 1.0E-18
sp|Q0TEX1|SYH_ECOL5 Histidine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|A1AE52|SYH_ECOK1 Histidine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|A8A320|SYH_ECOHS Histidine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B1XAY9|SYH_ECODH Histidine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|C4ZX89|SYH_ECOBW Histidine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B7M7L8|SYH_ECO8A Histidine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B7MYE9|SYH_ECO81 Histidine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B7NRG4|SYH_ECO7I Histidine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|B5Z0Y3|SYH_ECO5E Histidine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|P60908|SYH_ECO57 Histidine--tRNA ligase OS=Escherichia coli O157:H7 GN=hisS PE=3 SV=2 14 478 1.0E-18
sp|B7MHZ9|SYH_ECO45 Histidine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|A7ZPV7|SYH_ECO24 Histidine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|A0KUJ6|SYH_SHESA Histidine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=hisS PE=3 SV=1 5 467 1.0E-18
sp|C3PN13|SYH_RICAE Histidine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=hisS PE=3 SV=1 17 454 1.0E-18
sp|Q8Y708|SYH_LISMO Histidine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisS PE=3 SV=1 15 456 1.0E-18
sp|Q32D48|SYH_SHIDS Histidine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hisS PE=3 SV=1 14 478 1.0E-18
sp|Q6B910|SYH_GRATL Histidine--tRNA ligase, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=hisS PE=3 SV=1 21 361 2.0E-18
sp|B5YDT1|SYH_DICT6 Histidine--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=hisS PE=3 SV=1 15 363 2.0E-18
sp|C4L534|SYH_EXISA Histidine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hisS PE=3 SV=1 17 453 2.0E-18
sp|Q71ZF0|SYH_LISMF Histidine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisS PE=3 SV=1 15 456 2.0E-18
sp|B1KKJ3|SYH_SHEWM Histidine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=hisS PE=3 SV=1 5 476 2.0E-18
sp|Q03F51|SYH_PEDPA Histidine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=hisS PE=3 SV=1 15 456 3.0E-18
sp|O66522|SYH_AQUAE Histidine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=hisS PE=3 SV=1 15 455 3.0E-18
sp|Q601R3|SYH_MYCH2 Histidine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=hisS PE=3 SV=1 20 386 3.0E-18
sp|Q4UM71|SYH_RICFE Histidine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hisS PE=3 SV=1 17 454 3.0E-18
sp|A4XHB0|SYH_CALS8 Histidine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hisS PE=3 SV=1 15 475 3.0E-18
sp|A3DF35|SYH_CLOTH Histidine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisS PE=3 SV=1 18 475 4.0E-18
sp|B0BWZ9|SYH_RICRO Histidine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=hisS PE=3 SV=1 17 454 4.0E-18
sp|Q4A8C3|SYH_MYCH7 Histidine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=hisS PE=3 SV=1 20 386 4.0E-18
sp|B7UGW0|SYH_ECO27 Histidine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hisS PE=3 SV=1 14 478 4.0E-18
sp|Q83K44|SYH_SHIFL Histidine--tRNA ligase OS=Shigella flexneri GN=hisS PE=3 SV=3 14 478 5.0E-18
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 32 409 5.0E-18
sp|B1JDV7|SYH_PSEPW Histidine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=hisS PE=3 SV=1 40 456 5.0E-18
sp|A4JEN9|SYH_BURVG Histidine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisS PE=3 SV=1 21 472 5.0E-18
sp|C5BET0|SYH_EDWI9 Histidine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=hisS PE=3 SV=1 14 461 7.0E-18
sp|Q47BR7|SYH_DECAR Histidine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=hisS PE=3 SV=1 16 474 7.0E-18
sp|Q0BEW8|SYH_BURCM Histidine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisS PE=3 SV=1 21 472 8.0E-18
sp|B1YR43|SYH_BURA4 Histidine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=hisS PE=3 SV=1 21 472 8.0E-18
sp|C4LC38|SYH_TOLAT Histidine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=hisS PE=3 SV=1 5 472 8.0E-18
sp|Q31KX6|SYH_SYNE7 Histidine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=hisS PE=3 SV=1 16 456 9.0E-18
sp|A0K7T5|SYH_BURCH Histidine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=hisS PE=3 SV=1 21 472 9.0E-18
sp|Q1BGX3|SYH_BURCA Histidine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=hisS PE=3 SV=1 21 472 9.0E-18
sp|B2KBC0|SYH_ELUMP Histidine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=hisS PE=3 SV=1 18 479 9.0E-18
sp|B2GBY6|SYH_LACF3 Histidine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisS PE=3 SV=1 15 456 9.0E-18
sp|Q15R57|SYH_PSEA6 Histidine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hisS PE=3 SV=1 41 456 1.0E-17
sp|Q3ICZ6|SYH_PSEHT Histidine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hisS PE=3 SV=1 5 451 1.0E-17
sp|C6DBH3|SYH_PECCP Histidine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hisS PE=3 SV=1 14 456 1.0E-17
sp|Q3ZAI8|SYH_DEHM1 Histidine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisS PE=3 SV=1 18 476 1.0E-17
sp|A3NA53|SYH_BURP6 Histidine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=hisS PE=3 SV=1 21 472 1.0E-17
sp|B8E1C1|SYH_DICTD Histidine--tRNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=hisS PE=3 SV=1 15 455 1.0E-17
sp|B2JIV0|SYH_BURP8 Histidine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisS PE=3 SV=1 21 472 1.0E-17
sp|A1JKS3|SYH_YERE8 Histidine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hisS PE=3 SV=1 14 456 2.0E-17
sp|A8GMY5|SYH_RICAH Histidine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=hisS PE=3 SV=1 17 454 2.0E-17
sp|B2TXT9|SYH_SHIB3 Histidine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hisS PE=3 SV=1 14 478 2.0E-17
sp|Q46ZI4|SYH_CUPPJ Histidine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisS PE=3 SV=1 3 452 2.0E-17
sp|A5N1Y9|SYH_CLOK5 Histidine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisS PE=3 SV=1 15 452 2.0E-17
sp|B9E5P3|SYH_CLOK1 Histidine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisS PE=3 SV=1 15 452 2.0E-17
sp|A2BQA4|SYH_PROMS Histidine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=hisS PE=3 SV=1 16 459 2.0E-17
sp|Q5N0Z5|SYH_SYNP6 Histidine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisS PE=3 SV=1 16 456 2.0E-17
sp|B4EAW8|SYH_BURCJ Histidine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisS PE=3 SV=1 21 472 2.0E-17
sp|B1JT91|SYH_BURCC Histidine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=hisS PE=3 SV=1 21 472 2.0E-17
sp|Q2RWE3|SYH_RHORT Histidine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisS PE=3 SV=1 16 456 2.0E-17
sp|B9MPF7|SYH_CALBD Histidine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=hisS PE=3 SV=1 15 478 2.0E-17
sp|Q833I1|SYH_ENTFA Histidine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=hisS PE=3 SV=1 15 456 2.0E-17
sp|Q4AA96|SYH_MYCHJ Histidine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=hisS PE=3 SV=1 20 386 2.0E-17
sp|Q7V4P3|SYH_PROMM Histidine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=hisS PE=3 SV=2 20 470 3.0E-17
sp|A2BVT6|SYH_PROM5 Histidine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=hisS PE=3 SV=1 16 469 3.0E-17
sp|Q2NS41|SYH_SODGM Histidine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=hisS PE=3 SV=1 14 456 3.0E-17
sp|Q3JRQ5|SYH_BURP1 Histidine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=hisS PE=3 SV=1 21 472 3.0E-17
sp|A1V4K0|SYH_BURMS Histidine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=hisS PE=3 SV=1 21 472 3.0E-17
sp|Q62JW5|SYH_BURMA Histidine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=hisS PE=3 SV=1 21 472 3.0E-17
sp|A2S2A3|SYH_BURM9 Histidine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=hisS PE=3 SV=1 21 472 3.0E-17
sp|A3MK74|SYH_BURM7 Histidine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=hisS PE=3 SV=1 21 472 3.0E-17
sp|Q3AD55|HISZ_CARHZ ATP phosphoribosyltransferase regulatory subunit OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisZ PE=3 SV=1 20 356 3.0E-17
sp|Q63UT2|SYH_BURPS Histidine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=hisS PE=3 SV=1 21 472 4.0E-17
sp|A3NVX0|SYH_BURP0 Histidine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=hisS PE=3 SV=1 21 472 4.0E-17
sp|Q31XX6|SYH_SHIBS Histidine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=hisS PE=3 SV=1 14 478 4.0E-17
sp|Q8DMD8|HISZ_THEEB ATP phosphoribosyltransferase regulatory subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=hisZ PE=3 SV=1 44 357 4.0E-17
sp|Q55653|SYH_SYNY3 Histidine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisS PE=3 SV=1 21 477 4.0E-17
sp|C4LIW5|SYH_CORK4 Histidine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=hisS PE=3 SV=1 17 478 5.0E-17
sp|Q6D277|SYH_PECAS Histidine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisS PE=3 SV=1 14 456 5.0E-17
sp|Q39QK2|HISZ_GEOMG ATP phosphoribosyltransferase regulatory subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisZ PE=3 SV=1 20 373 6.0E-17
sp|Q1IZB5|SYH_DEIGD Histidine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=hisS PE=3 SV=1 15 455 6.0E-17
sp|Q2N5U7|SYH_ERYLH Histidine--tRNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=hisS PE=3 SV=1 15 356 6.0E-17
sp|Q39FR0|SYH_BURL3 Histidine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisS PE=3 SV=1 21 472 6.0E-17
sp|Q1ISE2|SYH_KORVE Histidine--tRNA ligase OS=Koribacter versatilis (strain Ellin345) GN=hisS PE=3 SV=1 17 456 7.0E-17
sp|Q0VNE1|SYH_ALCBS Histidine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisS PE=3 SV=1 44 453 7.0E-17
sp|A2CCR1|SYH_PROM3 Histidine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=hisS PE=3 SV=1 20 475 7.0E-17
sp|A9B9Z7|SYH_PROM4 Histidine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=hisS PE=3 SV=1 12 449 7.0E-17
sp|Q9ZDL9|SYH_RICPR Histidine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=hisS PE=3 SV=2 16 447 7.0E-17
sp|B5XNL6|SYH_KLEP3 Histidine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=hisS PE=3 SV=1 14 478 8.0E-17
sp|Q0K963|SYH_CUPNH Histidine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisS PE=3 SV=1 2 451 8.0E-17
sp|Q3AQK2|SYH_CHLCH Histidine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisS PE=3 SV=1 16 449 8.0E-17
sp|Q88PJ6|SYH_PSEPK Histidine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=hisS PE=3 SV=1 40 456 9.0E-17
sp|B0KPI8|SYH_PSEPG Histidine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=hisS PE=3 SV=1 40 456 9.0E-17
sp|A5VYT6|SYH_PSEP1 Histidine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisS PE=3 SV=1 40 456 9.0E-17
sp|C0QFI0|SYH_DESAH Histidine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hisS PE=3 SV=1 17 409 1.0E-16
sp|Q2SSF4|SYH_MYCCT Histidine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=hisS PE=3 SV=1 17 381 1.0E-16
sp|Q827T0|SYH_STRAW Histidine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisS PE=3 SV=1 16 456 1.0E-16
sp|P62372|SYH_MYCMS Histidine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=hisS PE=3 SV=1 17 447 1.0E-16
sp|B9M1R1|HISZ_GEODF ATP phosphoribosyltransferase regulatory subunit OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisZ PE=3 SV=1 20 367 1.0E-16
sp|Q317R4|SYH_DESAG Histidine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=hisS PE=3 SV=1 16 452 1.0E-16
sp|Q3K7B7|SYH_PSEPF Histidine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisS PE=3 SV=1 40 456 2.0E-16
sp|A8ZUR6|SYH_DESOH Histidine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisS PE=3 SV=1 45 383 2.0E-16
sp|A1BDE6|SYH_CHLPD Histidine--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisS PE=3 SV=1 21 457 2.0E-16
sp|Q7VCG1|SYH_PROMA Histidine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisS PE=3 SV=1 16 478 2.0E-16
sp|Q0BK72|SYH_FRATO Histidine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hisS PE=3 SV=1 44 457 2.0E-16
sp|Q2GBN6|SYH_NOVAD Histidine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisS PE=3 SV=1 15 410 2.0E-16
sp|A5CEP8|SYH_ORITB Histidine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=hisS PE=3 SV=1 14 356 2.0E-16
sp|B1W3H3|SYH_STRGG Histidine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisS PE=3 SV=1 16 478 2.0E-16
sp|A3PBZ7|SYH_PROM0 Histidine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=hisS PE=3 SV=1 16 459 3.0E-16
sp|B1WVZ0|SYH_CYAA5 Histidine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=hisS PE=3 SV=1 16 456 3.0E-16
sp|Q9RUN5|SYH_DEIRA Histidine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisS PE=3 SV=1 15 456 3.0E-16
sp|P47281|SYH_MYCGE Histidine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=hisS PE=3 SV=1 17 414 3.0E-16
sp|A4WD92|SYH_ENT38 Histidine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=hisS PE=3 SV=1 14 478 3.0E-16
sp|B2SXS9|SYH_BURPP Histidine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisS PE=3 SV=1 40 460 3.0E-16
sp|Q31I05|SYH_THICR Histidine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=hisS PE=3 SV=1 21 451 4.0E-16
sp|Q31BR1|SYH_PROM9 Histidine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=hisS PE=3 SV=1 16 459 4.0E-16
sp|C1CV35|SYH_DEIDV Histidine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=hisS PE=3 SV=1 15 452 4.0E-16
sp|A2SQI5|SYH_METLZ Histidine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisS PE=3 SV=1 17 360 4.0E-16
sp|B3QS95|SYH_CHLT3 Histidine--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisS PE=3 SV=1 15 453 5.0E-16
sp|B7K2B6|SYH_CYAP8 Histidine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=hisS PE=3 SV=1 16 466 5.0E-16
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1658
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1224 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5647
Ophiocordyceps camponoti-floridani Ophcf2|06335
Ophiocordyceps camponoti-rufipedis Ophun1|3524
Ophiocordyceps kimflemingae Ophio5|6739
Ophiocordyceps subramaniannii Hirsu2|1389

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1224
MASEAKKGKASRGALTLKTPKGTRDWSGPDMLLRDQVFNTITDIFKRHGGTPLDTPVFELKEILSGKYGEDSRLI
YDLEDQGGELCSLRFDLTVPFARWLAMNNIQQVKRYHLAKVYRRDQPAIARGRLREFHQCDFDIAGTYDPMIPDA
ETLRIIVEVFEALQVGITIKLNHRKILDGLFAVAGVPADKIRSISSAVDKLDKMAWPDVKKEMVDEKGLPDDVAD
RVGEYVQHSGTVTEMVEYLGADEKLCANPDIKAGIEDMTLLASYLTALQVIDKITFDLSLARGLDYYTGLIYEVI
NLPSKTEDKEGKKKNKDDAATQVGSMAAGGRYDNLVGMYGKRTIPCVGVSFGVDRIFTILKARRERENAAKPRGT
DVYVMAFGGKDFDGLLLERMSVAQRLWTAGIRAEFSPKVKPKLPQQFKAAEDVPLGVILGQDEMAAGQVRLKMLN
QGDDKSEEKDRGKLVSLDDLAQEVKKLLL*
Coding >OphauG2|1224
ATGGCATCTGAGGCTAAGAAGGGCAAGGCATCCCGTGGAGCTCTGACGCTCAAGACGCCCAAGGGAACACGGGAT
TGGAGTGGCCCCGACATGCTCCTGCGCGACCAAGTTTTCAATACTATTACCGACATCTTCAAGCGCCATGGCGGA
ACGCCTCTGGACACGCCAGTCTTTGAACTCAAAGAAATTCTCTCTGGCAAGTATGGCGAGGATTCTCGACTTATT
TACGACCTTGAAGATCAAGGAGGCGAGCTGTGCTCTTTGAGATTTGATCTGACCGTTCCATTTGCCCGCTGGCTG
GCCATGAACAACATCCAACAAGTGAAGCGCTATCATCTTGCCAAGGTTTACCGCCGAGACCAGCCGGCCATAGCT
CGTGGCCGTCTAAGAGAATTCCACCAATGCGACTTTGACATTGCCGGCACTTACGACCCTATGATTCCCGACGCT
GAGACTCTACGAATTATAGTCGAGGTTTTTGAAGCGCTGCAGGTTGGCATTACTATTAAGCTCAATCATCGCAAG
ATTCTCGACGGCTTGTTTGCCGTTGCTGGAGTTCCAGCCGACAAGATTCGCTCCATTAGCTCAGCAGTAGACAAG
CTGGATAAGATGGCATGGCCAGATGTCAAGAAGGAAATGGTTGACGAAAAGGGATTGCCAGACGACGTCGCTGAC
CGCGTCGGTGAATATGTCCAGCACAGCGGCACAGTTACCGAAATGGTGGAGTATCTAGGGGCAGACGAAAAACTT
TGCGCCAACCCAGACATCAAGGCCGGTATTGAGGATATGACTCTACTTGCGTCATATCTCACAGCGCTACAAGTT
ATTGATAAAATCACGTTTGATCTCTCGCTGGCGCGTGGCCTTGATTATTACACTGGACTGATCTACGAGGTGATC
AACCTCCCCTCCAAAACGGAGGACAAGGAAGGAAAAAAGAAGAACAAGGACGATGCAGCAACCCAGGTTGGGAGT
ATGGCTGCCGGCGGGCGTTACGACAATCTCGTCGGCATGTATGGCAAACGCACCATTCCGTGTGTCGGCGTATCA
TTTGGTGTCGACCGCATCTTCACCATTCTCAAAGCGCGGCGCGAACGAGAAAACGCGGCCAAGCCAAGAGGCACC
GATGTATATGTCATGGCATTTGGTGGCAAAGACTTTGATGGCTTGCTTCTAGAACGCATGTCGGTGGCACAGCGC
CTGTGGACGGCAGGCATTCGCGCCGAGTTTTCTCCAAAGGTGAAGCCCAAGCTCCCTCAGCAGTTCAAGGCAGCC
GAAGACGTGCCACTGGGTGTCATTCTGGGCCAGGATGAAATGGCAGCGGGCCAGGTGCGGTTAAAGATGCTTAAT
CAAGGGGACGACAAGTCGGAAGAGAAGGACCGGGGAAAGCTTGTAAGTCTTGACGATTTGGCTCAAGAGGTGAAG
AAGCTGTTGCTGTAG
Transcript >OphauG2|1224
ATGGCATCTGAGGCTAAGAAGGGCAAGGCATCCCGTGGAGCTCTGACGCTCAAGACGCCCAAGGGAACACGGGAT
TGGAGTGGCCCCGACATGCTCCTGCGCGACCAAGTTTTCAATACTATTACCGACATCTTCAAGCGCCATGGCGGA
ACGCCTCTGGACACGCCAGTCTTTGAACTCAAAGAAATTCTCTCTGGCAAGTATGGCGAGGATTCTCGACTTATT
TACGACCTTGAAGATCAAGGAGGCGAGCTGTGCTCTTTGAGATTTGATCTGACCGTTCCATTTGCCCGCTGGCTG
GCCATGAACAACATCCAACAAGTGAAGCGCTATCATCTTGCCAAGGTTTACCGCCGAGACCAGCCGGCCATAGCT
CGTGGCCGTCTAAGAGAATTCCACCAATGCGACTTTGACATTGCCGGCACTTACGACCCTATGATTCCCGACGCT
GAGACTCTACGAATTATAGTCGAGGTTTTTGAAGCGCTGCAGGTTGGCATTACTATTAAGCTCAATCATCGCAAG
ATTCTCGACGGCTTGTTTGCCGTTGCTGGAGTTCCAGCCGACAAGATTCGCTCCATTAGCTCAGCAGTAGACAAG
CTGGATAAGATGGCATGGCCAGATGTCAAGAAGGAAATGGTTGACGAAAAGGGATTGCCAGACGACGTCGCTGAC
CGCGTCGGTGAATATGTCCAGCACAGCGGCACAGTTACCGAAATGGTGGAGTATCTAGGGGCAGACGAAAAACTT
TGCGCCAACCCAGACATCAAGGCCGGTATTGAGGATATGACTCTACTTGCGTCATATCTCACAGCGCTACAAGTT
ATTGATAAAATCACGTTTGATCTCTCGCTGGCGCGTGGCCTTGATTATTACACTGGACTGATCTACGAGGTGATC
AACCTCCCCTCCAAAACGGAGGACAAGGAAGGAAAAAAGAAGAACAAGGACGATGCAGCAACCCAGGTTGGGAGT
ATGGCTGCCGGCGGGCGTTACGACAATCTCGTCGGCATGTATGGCAAACGCACCATTCCGTGTGTCGGCGTATCA
TTTGGTGTCGACCGCATCTTCACCATTCTCAAAGCGCGGCGCGAACGAGAAAACGCGGCCAAGCCAAGAGGCACC
GATGTATATGTCATGGCATTTGGTGGCAAAGACTTTGATGGCTTGCTTCTAGAACGCATGTCGGTGGCACAGCGC
CTGTGGACGGCAGGCATTCGCGCCGAGTTTTCTCCAAAGGTGAAGCCCAAGCTCCCTCAGCAGTTCAAGGCAGCC
GAAGACGTGCCACTGGGTGTCATTCTGGGCCAGGATGAAATGGCAGCGGGCCAGGTGCGGTTAAAGATGCTTAAT
CAAGGGGACGACAAGTCGGAAGAGAAGGACCGGGGAAAGCTTGTAAGTCTTGACGATTTGGCTCAAGAGGTGAAG
AAGCTGTTGCTGTAG
Gene >OphauG2|1224
ATGGCATCTGAGGCTAAGAAGGGCAAGGCATCCCGTGGAGCTCTGACGCTCAAGACGCCCAAGGGAACACGGGAT
TGGAGTGGCCCCGACATGCTCCTGCGCGACCAAGTTTTGTATGTGTCGCTTGGCTAGCTGTTGAGAGAGGCGCTC
CTAATACTAGACGTGCAGCAATACTATTACCGACATCTTCAAGCGCCATGGCGGAACGCCTCTGGACACGCCAGT
CTTTGAACTCAAAGAAATTCTCTCTGGCAGTAGGTACTGACACCTTGGCTGTCTCGGGCGCTTCTAACATTGCTC
AATAGAGTATGGCGAGGATTCTCGACTTATTTACGACCTTGAAGATCAAGGAGGCGAGCTGTGCTCTTTGAGATT
TGATCTGACCGTTCCATTTGCCCGCTGGCTGGCCATGAACAACATCCAACAAGTGAAGCGCTATCATCTTGCCAA
GGTTTACCGCCGAGACCAGCCGGCCATAGCTCGTGGCCGTCTAAGAGAATTCCACCAATGCGACTTTGACATTGC
CGGCACTTACGACCCTATGATTCCCGACGCTGAGACTCTACGAATTATAGTCGAGGTTTTTGAAGCGCTGCAGGT
TGGCATTACTATTAAGCTCAATCATCGCAAGATTCTCGACGGCTTGTTTGCCGTTGCTGGAGTTCCAGCCGACAA
GATTCGCTCCATTAGCTCAGCAGTAGACAAGCTGGATAAGATGGCATGGCCAGATGTCAAGAAGGAAATGGTTGA
CGAAAAGGGATTGCCAGACGACGTCGCTGACCGCGTCGGTGAATATGTCCAGCACAGCGGCACAGTTACCGAAAT
GGTGGAGTATCTAGGGGCAGACGAAAAACTTTGCGCCAACCCAGACATCAAGGCCGGTATTGAGGATATGACTCT
ACTTGCGTCATATCTCACAGCGCTACAAGTTATTGATAAAATCACGTTTGATCTCTCGCTGGCGCGTGGCCTTGA
TTATTACACTGGACTGATCTACGAGGTGATCAACCTCCCCTCCAAAACGGAGGACAAGGAAGGAAAAAAGAAGAA
CAAGGACGATGCAGCAACCCAGGTTGGGAGTATGGCTGCCGGCGGGCGTTACGACAATCTCGTCGGCATGTATGG
CAAACGCACCATTCCGTGTGTCGGCGTATCATTTGGTGTCGACCGCATCTTCACCATTCTCAAAGCGCGGCGCGA
ACGAGAAAACGCGGCCAAGCCAAGAGGCACCGATGTATATGTCATGGCATTTGGTGGCAAAGACTTTGATGGCTT
GCTTCTAGAACGCATGTCGGTGGCACAGCGCCTGTGGACGGCAGGCATTCGCGCCGAGTTTTCTCCAAAGGTGAA
GCCCAAGCTCCCTCAGCAGTTCAAGGCAGCCGAAGACGTGCCACTGGGTGTCATTCTGGGCCAGGATGAAATGGC
AGCGGGCCAGGTGCGGTTAAAGATGCTTAATCAAGGGGACGACAAGTCGGAAGAGAAGGACCGGGGAAAGCTTGT
AAGTCTTGACGATTTGGCTCAAGAGGTGAAGAAGCTGTTGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail