Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|121
Gene name
LocationContig_1012:2559..5106
Strand-
Gene length (bp)2547
Transcript length (bp)2346
Coding sequence length (bp)2346
Protein length (aa) 782

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12044 Metallopep Putative peptidase family 2.6E-164 123 551
PF01419 Jacalin Jacalin-like lectin domain 4.2E-05 670 778

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40483|YIK8_YEAST Putative zinc metalloproteinase YIL108W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL108W PE=1 SV=1 125 778 3.0E-128
sp|Q9US12|YK66_SCHPO Putative zinc metalloproteinase C607.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.06c PE=2 SV=1 125 780 1.0E-110

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|121 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3957
Ophiocordyceps camponoti-floridani Ophcf2|03226
Ophiocordyceps camponoti-rufipedis Ophun1|882
Ophiocordyceps kimflemingae Ophio5|94
Ophiocordyceps subramaniannii Hirsu2|8857

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|121
MSPSFLTLKELRRRSKASFRTNNSTDGSSDGVMSHGTSPSSGSVTPPSIAQQSDPALDSQVNNNKNSQASSQQNA
PPPPPPPSTRPMMAPGSNASRQSVSGMSGLGSPSQTGKSSLPLSKYAPRIHNVSENSWVYQKVLLIHGVIGESGL
PPIDGTIVVSRFDDSFPPVTWPVCESHFKAIIYLQPGPNKFRFDFFSPKLANSSSSNPIHASYLTLHMLPALNAP
PLQLAIVLGCDSPATFDAVPARAEREGNGLDTAIRKFRMAAYLWQAFTAEQMWRHRLGRRVFRFEEEWMPGSCNY
RDRENGTMRSEARIHVIRADKTVAELRQLDRAQQNDKATNKNSLFDISVDAVNKYFKPLPGQKNYVSVLLLDAHW
DTKSSIITGHAALGGGCGDLQLAIFGSHCLQSYPTSFEEVVPAFTDCTPTDTKYVANDCNDAGSSWEAVNIGIGA
HLHETGHLFGCPHQESGIMLRDYVVLNRSFVPREAYSTRTKCKGGLALQGDECGWHRLDALRFRAHPAFRLPNDA
MPNPDDSVQVFAMDGGSLTAMAASGISFVEIYGEGDDVCHSWIEFSVDNGPVQRQIVLHDQDVRSRLPDAKRKGH
VRISIKSNGGGSLTVDDWKAFTGRDSMVKLANGKLASKSLQLGASKMDNSQPQQVVFRSAVENGRIMSRIVVYHG
SAVDGIEFIYDDDSTQLFGKKGGKAGGDVVEFDVRKGEYLSGFVVRAGYWIDGVQILTSLGRKSTVFGNAHGGSA
HTLIPPRGYAICGVSGSCGAWVDGFSVLVKR*
Coding >OphauG2|121
ATGTCGCCCAGCTTCTTGACCCTCAAAGAGCTTCGGCGACGCTCCAAGGCCAGTTTTCGAACCAACAACTCAACC
GATGGATCAAGCGACGGCGTCATGAGCCATGGCACCTCCCCTTCAAGCGGCTCCGTCACTCCCCCGTCTATTGCC
CAGCAATCAGATCCTGCCCTCGATTCCCAGGTCAACAACAATAAAAACTCGCAAGCCAGCAGCCAGCAAAATGCT
CCTCCCCCGCCACCGCCACCATCAACTCGACCCATGATGGCCCCCGGCTCCAACGCGAGTAGACAGAGCGTTTCC
GGCATGTCTGGCCTCGGTTCACCTTCCCAGACTGGCAAGAGCAGTCTTCCCTTGTCCAAATATGCGCCGCGCATC
CACAACGTCTCTGAAAACTCATGGGTCTACCAAAAGGTGCTTCTCATACACGGCGTCATTGGCGAGTCGGGGCTC
CCCCCCATTGACGGTACCATTGTCGTTAGCAGATTCGACGATAGCTTCCCACCCGTTACTTGGCCAGTTTGCGAA
TCCCACTTCAAGGCCATCATATATCTGCAGCCAGGTCCCAATAAGTTCAGGTTCGACTTTTTCAGTCCCAAGCTG
GCCAATAGCTCCTCGTCGAATCCCATACATGCCTCTTACCTTACTCTTCATATGCTGCCCGCGCTGAATGCGCCT
CCGCTCCAGCTTGCAATTGTCCTGGGCTGTGATTCTCCTGCGACCTTTGATGCTGTTCCCGCCAGGGCGGAGAGG
GAGGGCAATGGACTCGACACAGCCATACGCAAGTTTCGCATGGCTGCCTATCTCTGGCAGGCCTTTACGGCCGAG
CAGATGTGGCGGCACAGACTAGGTCGTCGTGTCTTTCGCTTTGAAGAGGAGTGGATGCCAGGCTCGTGCAATTAT
CGCGATAGGGAGAATGGCACTATGCGATCAGAGGCCAGAATACACGTCATACGAGCCGACAAGACGGTTGCCGAG
CTTCGTCAATTGGACAGAGCTCAGCAGAATGACAAGGCCACTAACAAGAATTCCCTCTTTGACATTTCTGTCGAT
GCAGTCAACAAGTATTTCAAACCTTTACCGGGCCAAAAAAACTATGTCTCGGTTCTACTACTAGATGCCCATTGG
GATACCAAATCAAGCATTATTACCGGCCACGCCGCCCTAGGAGGAGGTTGTGGCGATTTGCAACTGGCAATCTTT
GGTTCGCACTGCCTACAAAGTTATCCCACGAGCTTTGAAGAAGTGGTGCCTGCCTTTACCGACTGTACCCCTACC
GACACCAAGTATGTCGCCAATGACTGCAACGACGCCGGTAGCTCTTGGGAGGCAGTCAACATTGGCATTGGGGCC
CACCTGCACGAAACTGGACACCTCTTTGGATGCCCTCATCAGGAATCGGGCATCATGCTCCGAGACTACGTGGTA
CTTAACCGCTCGTTTGTTCCACGCGAGGCCTACTCGACAAGAACAAAGTGTAAGGGCGGACTGGCTTTGCAGGGT
GACGAGTGTGGTTGGCACCGCCTTGACGCTCTGCGGTTCCGGGCTCATCCCGCCTTTCGGCTCCCAAATGACGCC
ATGCCAAACCCCGATGACAGTGTCCAGGTCTTCGCCATGGATGGTGGCTCCTTGACGGCCATGGCGGCTTCAGGC
ATTTCATTTGTCGAAATTTATGGCGAGGGCGACGACGTCTGCCATTCTTGGATTGAATTTTCGGTTGATAATGGT
CCGGTTCAGCGTCAGATTGTTTTACACGACCAGGACGTGCGGTCAAGGCTTCCCGACGCCAAGAGAAAAGGTCAT
GTTCGGATATCCATCAAATCAAACGGTGGAGGCTCGCTTACTGTAGACGACTGGAAGGCATTCACAGGCAGGGAC
TCAATGGTCAAGCTTGCCAATGGCAAGCTTGCTTCGAAAAGCCTACAACTTGGTGCCTCCAAAATGGATAACAGT
CAGCCACAGCAGGTTGTCTTTCGCAGCGCTGTGGAGAATGGTCGCATCATGTCACGCATAGTTGTGTATCATGGC
TCCGCTGTTGACGGCATCGAATTTATCTACGATGACGATTCTACGCAGCTCTTTGGAAAAAAAGGAGGCAAGGCC
GGGGGAGACGTGGTAGAGTTTGATGTTCGCAAGGGCGAGTATTTGAGCGGCTTTGTGGTGAGGGCTGGCTACTGG
ATTGACGGTGTACAAATCTTAACAAGCCTGGGGCGGAAGTCTACAGTTTTTGGAAATGCGCACGGGGGATCTGCA
CATACTTTGATTCCTCCTCGTGGATACGCAATTTGCGGCGTTTCGGGCTCATGTGGTGCTTGGGTTGATGGCTTC
TCGGTTCTCGTTAAACGTTGA
Transcript >OphauG2|121
ATGTCGCCCAGCTTCTTGACCCTCAAAGAGCTTCGGCGACGCTCCAAGGCCAGTTTTCGAACCAACAACTCAACC
GATGGATCAAGCGACGGCGTCATGAGCCATGGCACCTCCCCTTCAAGCGGCTCCGTCACTCCCCCGTCTATTGCC
CAGCAATCAGATCCTGCCCTCGATTCCCAGGTCAACAACAATAAAAACTCGCAAGCCAGCAGCCAGCAAAATGCT
CCTCCCCCGCCACCGCCACCATCAACTCGACCCATGATGGCCCCCGGCTCCAACGCGAGTAGACAGAGCGTTTCC
GGCATGTCTGGCCTCGGTTCACCTTCCCAGACTGGCAAGAGCAGTCTTCCCTTGTCCAAATATGCGCCGCGCATC
CACAACGTCTCTGAAAACTCATGGGTCTACCAAAAGGTGCTTCTCATACACGGCGTCATTGGCGAGTCGGGGCTC
CCCCCCATTGACGGTACCATTGTCGTTAGCAGATTCGACGATAGCTTCCCACCCGTTACTTGGCCAGTTTGCGAA
TCCCACTTCAAGGCCATCATATATCTGCAGCCAGGTCCCAATAAGTTCAGGTTCGACTTTTTCAGTCCCAAGCTG
GCCAATAGCTCCTCGTCGAATCCCATACATGCCTCTTACCTTACTCTTCATATGCTGCCCGCGCTGAATGCGCCT
CCGCTCCAGCTTGCAATTGTCCTGGGCTGTGATTCTCCTGCGACCTTTGATGCTGTTCCCGCCAGGGCGGAGAGG
GAGGGCAATGGACTCGACACAGCCATACGCAAGTTTCGCATGGCTGCCTATCTCTGGCAGGCCTTTACGGCCGAG
CAGATGTGGCGGCACAGACTAGGTCGTCGTGTCTTTCGCTTTGAAGAGGAGTGGATGCCAGGCTCGTGCAATTAT
CGCGATAGGGAGAATGGCACTATGCGATCAGAGGCCAGAATACACGTCATACGAGCCGACAAGACGGTTGCCGAG
CTTCGTCAATTGGACAGAGCTCAGCAGAATGACAAGGCCACTAACAAGAATTCCCTCTTTGACATTTCTGTCGAT
GCAGTCAACAAGTATTTCAAACCTTTACCGGGCCAAAAAAACTATGTCTCGGTTCTACTACTAGATGCCCATTGG
GATACCAAATCAAGCATTATTACCGGCCACGCCGCCCTAGGAGGAGGTTGTGGCGATTTGCAACTGGCAATCTTT
GGTTCGCACTGCCTACAAAGTTATCCCACGAGCTTTGAAGAAGTGGTGCCTGCCTTTACCGACTGTACCCCTACC
GACACCAAGTATGTCGCCAATGACTGCAACGACGCCGGTAGCTCTTGGGAGGCAGTCAACATTGGCATTGGGGCC
CACCTGCACGAAACTGGACACCTCTTTGGATGCCCTCATCAGGAATCGGGCATCATGCTCCGAGACTACGTGGTA
CTTAACCGCTCGTTTGTTCCACGCGAGGCCTACTCGACAAGAACAAAGTGTAAGGGCGGACTGGCTTTGCAGGGT
GACGAGTGTGGTTGGCACCGCCTTGACGCTCTGCGGTTCCGGGCTCATCCCGCCTTTCGGCTCCCAAATGACGCC
ATGCCAAACCCCGATGACAGTGTCCAGGTCTTCGCCATGGATGGTGGCTCCTTGACGGCCATGGCGGCTTCAGGC
ATTTCATTTGTCGAAATTTATGGCGAGGGCGACGACGTCTGCCATTCTTGGATTGAATTTTCGGTTGATAATGGT
CCGGTTCAGCGTCAGATTGTTTTACACGACCAGGACGTGCGGTCAAGGCTTCCCGACGCCAAGAGAAAAGGTCAT
GTTCGGATATCCATCAAATCAAACGGTGGAGGCTCGCTTACTGTAGACGACTGGAAGGCATTCACAGGCAGGGAC
TCAATGGTCAAGCTTGCCAATGGCAAGCTTGCTTCGAAAAGCCTACAACTTGGTGCCTCCAAAATGGATAACAGT
CAGCCACAGCAGGTTGTCTTTCGCAGCGCTGTGGAGAATGGTCGCATCATGTCACGCATAGTTGTGTATCATGGC
TCCGCTGTTGACGGCATCGAATTTATCTACGATGACGATTCTACGCAGCTCTTTGGAAAAAAAGGAGGCAAGGCC
GGGGGAGACGTGGTAGAGTTTGATGTTCGCAAGGGCGAGTATTTGAGCGGCTTTGTGGTGAGGGCTGGCTACTGG
ATTGACGGTGTACAAATCTTAACAAGCCTGGGGCGGAAGTCTACAGTTTTTGGAAATGCGCACGGGGGATCTGCA
CATACTTTGATTCCTCCTCGTGGATACGCAATTTGCGGCGTTTCGGGCTCATGTGGTGCTTGGGTTGATGGCTTC
TCGGTTCTCGTTAAACGTTGA
Gene >OphauG2|121
ATGTCGCCCAGCTTCTTGACCCTCAAAGAGCTTCGGCGACGCTCCAAGGCCAGTTTTCGAACCAACAACTCAACC
GATGGATCAAGCGACGGCGTCATGAGCCATGGCACCTCCCCTTCAAGCGGCTCCGTCACTCCCCCGTCTATTGCC
CAGCAATCAGATCCTGCCCTCGATTCCCAGGTCAACAACAATAAAAACTCGCAAGCCAGCAGCCAGCAAAATGCT
CCTCCCCCGCCACCGCCACCATCAACTCGACCCATGATGGCCCCCGGCTCCAACGCGAGTAGACAGAGCGTTTCC
GGCATGTCTGGCCTCGGTTCACCTTCCCAGACTGGCAAGAGCAGTCTTCCCTTGTCCAAATATGCGCCGCGCATC
CACAACGTCTCTGAAAACTCATGGGTTTGTTGTTTCTCGCTTGCCATGCCATGCCTATTGGCTCCCTAGTCTCGG
CTTGTTTTCCTCTGACTCGCTTCATCTAGGTCTACCAAAAGGTGCTTCTCATACACGGCGTCATTGGCGAGTCGG
GGCTCCCCCCCATTGACGGTACCATTGTCGTTAGCAGATTCGACGATAGCTTCCCACCCGTTACTTGGCCAGTTT
GCGAATCCCACTTCAAGGCCATCATATATCTGCAGCCAGGTCCCAATAAGTTCAGGTTCGACTTTTTCAGTCCCA
AGCTGGCCAATAGCTCCTCGTCGAATCCCATACATGCCTCTTACCTTACTCTTCATATGCTGCCCGCGCTGAATG
CGCCTCCGCTCCAGCTTGCAATTGTCCTGGGCTGTGATTCTCCTGCGACCTTTGATGCTGTTCCCGCCAGGGCGG
AGAGGGAGGGCAATGGACTCGACACAGCCATACGCAAGTTTCGCATGGCTGCCTATCTCTGGCAGGCCTTTACGG
CCGAGCAGATGTGGCGGCACAGACTAGGTCGTCGTGTCTTTCGCTTTGAAGAGGAGTGGATGCCAGGCTCGTGCA
ATTATCGCGATAGGGAGAATGGCACTATGCGATCAGAGGCCAGAATACACGTCATACGAGCCGACAAGACGGTTG
CCGAGCTTCGTCAATTGGACAGAGCTCAGCAGAATGACAAGGCCACTAACAAGAATTCCCTCTTTGACATTTCTG
TCGATGCAGTCAACAAGTATTTCAAACCTTTACCGGGCCAAAAAAACTATGTCTCGGTTCTACTACTAGATGCCC
ATTGGGATACCAAATCAAGCATTATTACCGGCCACGCCGCCCTAGGAGGAGGTTGTGGCGATTTGCAACTGGCAA
TCTTTGGTTCGCACTGCCTACAAAGTTATCCCACGAGCTTTGAAGAAGTGGTGCCTGCCTTTACCGACTGTACCC
CTACCGACACCAAGTATGTCGCCAATGACTGCAACGACGCCGGTAGCTCTTGGGAGGCAGTCAACATTGGCATTG
GGGCCCACCTGCACGAAACTGGACACCTCTTTGGATGCCCTCATCAGGAATCGGGCATCATGCTCCGAGACTACG
TGGTACTTAACCGCTCGTTTGTTCCACGCGAGGCCTACTCGACAAGAACAAAGTGTAAGGGCGGACTGGCTTTGC
AGGGTGACGAGTGTGGTTGGCACCGCCTTGACGCTCTGCGGTTCCGGGCTCATCCCGCCTTTCGGCTCCCAAATG
ACGCCATGCCAAACCCCGATGACAGTGTCCAGGTCTTCGCCATGGATGGTGGCTCCTTGACGGCCATGGCGGCTT
CAGGCATTTCATTTGTCGAAATTTATGGCGAGGGCGACGACGTCTGCCATTCTTGGATTGAATTTTCGGTTGATA
ATGGTCCGGTTCAGCGTCAGATTGTTTTACACGACCAGGACGTGCGGTCAAGGCTTCCCGACGCCAAGAGAAAAG
GTCATGTTCGGATATCCATCAAATCAAACGGTGGAGGCTCGCTTACTGTAGACGACTGGAAGGCATTCACAGGCA
GGGACTCAATGGTCAAGCTTGCCAATGGCAAGCTTGCTTCGAAAAGCCTACAACTTGGTGCCTCCAAAATGGATA
ACAGTCAGCCACAGCAGGTTGTCTTTCGCAGCGCTGTGGAGAATGGTCGCATCATGTCACGCATAGTTGTGTATC
ATGGCTCCGCTGTTGACGGCATCGAATTTATCTACGATGACGATTCTACGCAGCTCTTTGGAAAAAAAGGAGGCA
AGGCCGGGGGAGACGTGGTAGAGTTTGGTGTGTCTATGATTGAGGTAACCCGCGGGCAGGAGTTGAAGCCATGCT
AATGTTTGCTTTTTAGATGTTCGCAAGGGCGAGTATTTGAGCGGCTTTGTGGTGAGGGCTGGCTACTGGATTGAC
GGTGTACAAATCTTAACAAGCCTGGGGCGGAAGTCTACAGTTTTTGGAAATGCGCACGGGGGATCTGCGTATGTT
GATCTATGACAATGGCCCTGGAGAGCTCGCTGACGACGATTGCTGAACAGACATACTTTGATTCCTCCTCGTGGA
TACGCAATTTGCGGCGTTTCGGGCTCATGTGGTGCTTGGGTTGATGGCTTCTCGGTTCTCGTTAAACGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail