Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1203
Gene name
LocationContig_1345:2711..4319
Strand-
Gene length (bp)1608
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.5E-10 14 74
PF00743 FMO-like Flavin-binding monooxygenase-like 6.6E-09 12 202
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 1.8E-07 79 210
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.3E-08 11 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 4 534 6.0E-133
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 3 508 5.0E-109
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 10 533 4.0E-95
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 1 531 1.0E-93
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 11 529 5.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 4 534 6.0E-133
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 3 508 5.0E-109
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 10 533 4.0E-95
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 1 531 1.0E-93
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 11 529 5.0E-87
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 7 527 1.0E-84
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 10 523 9.0E-43
sp|E3VWK3|PENE_STREX Pentalenolactone D synthase OS=Streptomyces exfoliatus GN=penE PE=1 SV=1 10 478 6.0E-41
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 12 468 1.0E-38
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 12 479 2.0E-38
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 12 499 3.0E-37
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 12 499 3.0E-37
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 12 499 3.0E-37
sp|E3VWI7|PNTE_STRAE Pentalenolactone D synthase OS=Streptomyces arenae GN=pntE PE=1 SV=1 10 478 7.0E-36
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 12 478 2.0E-34
sp|Q82IY8|PTLE_STRAW Neopentalenolactone D synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlE PE=1 SV=1 34 487 2.0E-34
sp|U5S003|BVMO4_DIESD Baeyer-Villiger monooxygenase 4 OS=Dietzia sp. (strain D5) PE=1 SV=1 36 475 2.0E-30
sp|Q9RL17|BVMO1_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0300 PE=1 SV=1 28 447 7.0E-30
sp|Q00730|STCW_EMENI Putative sterigmatocystin biosynthesis monooxygenase stcW OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcW PE=3 SV=2 12 512 1.0E-25
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 10 210 4.0E-21
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 11 211 1.0E-18
sp|A1CLY7|CCSB_ASPCL Ketocytochalasin monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsB PE=1 SV=1 12 212 3.0E-18
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 10 484 2.0E-17
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 10 484 2.0E-17
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 10 484 2.0E-17
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 11 218 2.0E-15
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 11 218 2.0E-15
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 13 215 1.0E-11
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 13 215 2.0E-11
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 13 215 2.0E-11
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 13 215 3.0E-11
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 13 215 3.0E-11
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 13 421 1.0E-10
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 13 215 3.0E-10
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 13 215 4.0E-10
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 12 490 8.0E-10
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 8 215 2.0E-09
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 12 209 2.0E-08
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 12 208 4.0E-08
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 12 210 3.0E-07
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 12 209 4.0E-07
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 12 209 4.0E-07
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 12 209 5.0E-07
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 12 209 6.0E-07
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 12 209 9.0E-07
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 8 208 1.0E-06
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 12 209 2.0E-06
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 12 209 3.0E-06
sp|P64766|Y968_MYCBO Uncharacterized protein Mb0968c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0968c PE=4 SV=1 356 469 3.0E-06
sp|P9WKN7|Y943_MYCTU Uncharacterized protein Rv0943c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0943c PE=4 SV=1 356 469 3.0E-06
sp|P9WKN6|Y943_MYCTO Uncharacterized protein MT0969 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0969 PE=4 SV=1 356 469 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0004497 monooxygenase activity No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup418
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1203 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5874
Ophiocordyceps australis map64 (Brazil) OphauB2|78
Ophiocordyceps camponoti-floridani Ophcf2|00015
Ophiocordyceps camponoti-rufipedis Ophun1|2799
Ophiocordyceps kimflemingae Ophio5|1784
Ophiocordyceps kimflemingae Ophio5|4092
Ophiocordyceps subramaniannii Hirsu2|3631
Ophiocordyceps subramaniannii Hirsu2|7961

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1203
MGSSEDKIVVDVIVVGAGFGGCYALHHLRAQGYSTKVLEAGSGLGGVWHFNRYPGCRVDSEAPVYQLSLPQAWAT
FDFKDRYPAREELENYFGHLDKTLQLGKDVIFNARVARAEYDAGKNTWEFCTQDGLKATGRYAVFACGTTHKAYI
PEFKKLDEYKGLVIHPSRWPQDVNVKGKKIGIIGQGASALQIIQDVAKQECELTVFIRTPCNAFPMGARSIQESK
DEYQEAFDKAKKQSEQGYAIDAFPVSYHGATAQQRRHHYEQLWARGGYGVFMSNYYDILLDKEANGDFYAFWAAK
VRARMSDPVKRDIVAPLKQSQWIGTKRATLECDYYEMLDRANVKLVNLKKTPMTQFCSAGIMVDDAAQPVHELDI
VILATGYDAVTGSLYDTHIHGRDGVSLQEKWQGGISTFLGLMAPGFPNAFLLYGPQAPTSLVNAPPLLELQVEWV
ARVLEEMKRRGMACIDVRERAAAEWSQKTWAAFNATLSRETGSWWTGENIPGKKREPLIWFGGMRGWWRECERAL
ENWGDFVVDG*
Coding >OphauG2|1203
ATGGGCAGCTCAGAGGACAAAATCGTGGTCGACGTGATTGTGGTGGGCGCCGGGTTTGGAGGATGCTACGCCCTC
CATCATCTGCGGGCCCAGGGCTACTCGACAAAGGTTCTCGAAGCTGGCAGCGGGCTGGGAGGAGTGTGGCACTTT
AACCGGTACCCTGGATGTCGAGTTGATTCCGAAGCTCCCGTCTATCAACTGAGCTTGCCGCAGGCGTGGGCGACG
TTTGATTTCAAGGACCGGTATCCCGCGCGAGAGGAGCTTGAGAATTACTTTGGCCACTTGGATAAGACGCTTCAA
CTAGGCAAGGACGTGATATTCAACGCCAGGGTGGCCAGGGCGGAATATGACGCGGGGAAAAACACGTGGGAGTTT
TGCACGCAAGACGGACTGAAAGCGACGGGTCGATACGCCGTGTTTGCCTGTGGCACAACACACAAGGCTTACATT
CCCGAGTTTAAGAAGCTAGACGAGTACAAAGGGCTGGTGATTCACCCTTCGCGGTGGCCGCAAGACGTGAATGTC
AAGGGCAAGAAAATCGGGATAATCGGACAAGGCGCGTCGGCACTGCAAATCATCCAAGACGTTGCCAAGCAGGAG
TGTGAGTTGACGGTGTTTATCCGCACGCCTTGCAACGCGTTTCCCATGGGCGCGCGATCGATTCAGGAATCAAAA
GACGAGTACCAAGAGGCGTTTGACAAGGCCAAGAAGCAAAGCGAGCAGGGCTATGCCATTGATGCGTTTCCTGTT
TCCTACCATGGGGCCACGGCTCAGCAACGGCGGCATCACTACGAGCAGCTTTGGGCTCGGGGCGGATACGGCGTG
TTTATGAGCAACTACTACGACATTCTGCTCGACAAGGAAGCAAATGGCGACTTTTATGCGTTTTGGGCAGCCAAA
GTGCGGGCTCGAATGTCGGATCCCGTCAAGCGCGACATTGTGGCGCCGCTCAAACAGAGTCAATGGATTGGCACA
AAACGAGCGACTCTGGAATGCGACTACTACGAAATGCTGGACCGGGCCAACGTGAAACTCGTCAATCTCAAAAAG
ACGCCCATGACGCAGTTTTGCAGCGCCGGCATCATGGTCGACGACGCTGCGCAGCCCGTCCACGAGCTCGACATT
GTCATCCTGGCCACTGGATACGACGCTGTCACCGGCAGTCTGTACGACACGCACATCCACGGGCGGGACGGCGTC
TCGCTGCAGGAGAAATGGCAGGGCGGCATCTCGACGTTTCTCGGACTCATGGCGCCTGGCTTCCCCAACGCGTTT
CTGCTGTACGGGCCGCAGGCGCCCACGTCGCTGGTCAACGCGCCGCCGCTGCTGGAACTGCAGGTGGAGTGGGTT
GCACGAGTGCTGGAGGAGATGAAGCGGAGGGGGATGGCGTGCATCGACGTGAGGGAAAGGGCGGCGGCAGAGTGG
TCGCAAAAGACGTGGGCGGCGTTTAACGCCACGCTGAGCAGGGAGACGGGGTCGTGGTGGACGGGGGAGAATATC
CCGGGCAAGAAGCGCGAGCCGCTGATTTGGTTTGGCGGGATGCGCGGGTGGTGGAGGGAGTGCGAGAGGGCGTTG
GAGAATTGGGGTGATTTTGTCGTCGATGGCTAG
Transcript >OphauG2|1203
ATGGGCAGCTCAGAGGACAAAATCGTGGTCGACGTGATTGTGGTGGGCGCCGGGTTTGGAGGATGCTACGCCCTC
CATCATCTGCGGGCCCAGGGCTACTCGACAAAGGTTCTCGAAGCTGGCAGCGGGCTGGGAGGAGTGTGGCACTTT
AACCGGTACCCTGGATGTCGAGTTGATTCCGAAGCTCCCGTCTATCAACTGAGCTTGCCGCAGGCGTGGGCGACG
TTTGATTTCAAGGACCGGTATCCCGCGCGAGAGGAGCTTGAGAATTACTTTGGCCACTTGGATAAGACGCTTCAA
CTAGGCAAGGACGTGATATTCAACGCCAGGGTGGCCAGGGCGGAATATGACGCGGGGAAAAACACGTGGGAGTTT
TGCACGCAAGACGGACTGAAAGCGACGGGTCGATACGCCGTGTTTGCCTGTGGCACAACACACAAGGCTTACATT
CCCGAGTTTAAGAAGCTAGACGAGTACAAAGGGCTGGTGATTCACCCTTCGCGGTGGCCGCAAGACGTGAATGTC
AAGGGCAAGAAAATCGGGATAATCGGACAAGGCGCGTCGGCACTGCAAATCATCCAAGACGTTGCCAAGCAGGAG
TGTGAGTTGACGGTGTTTATCCGCACGCCTTGCAACGCGTTTCCCATGGGCGCGCGATCGATTCAGGAATCAAAA
GACGAGTACCAAGAGGCGTTTGACAAGGCCAAGAAGCAAAGCGAGCAGGGCTATGCCATTGATGCGTTTCCTGTT
TCCTACCATGGGGCCACGGCTCAGCAACGGCGGCATCACTACGAGCAGCTTTGGGCTCGGGGCGGATACGGCGTG
TTTATGAGCAACTACTACGACATTCTGCTCGACAAGGAAGCAAATGGCGACTTTTATGCGTTTTGGGCAGCCAAA
GTGCGGGCTCGAATGTCGGATCCCGTCAAGCGCGACATTGTGGCGCCGCTCAAACAGAGTCAATGGATTGGCACA
AAACGAGCGACTCTGGAATGCGACTACTACGAAATGCTGGACCGGGCCAACGTGAAACTCGTCAATCTCAAAAAG
ACGCCCATGACGCAGTTTTGCAGCGCCGGCATCATGGTCGACGACGCTGCGCAGCCCGTCCACGAGCTCGACATT
GTCATCCTGGCCACTGGATACGACGCTGTCACCGGCAGTCTGTACGACACGCACATCCACGGGCGGGACGGCGTC
TCGCTGCAGGAGAAATGGCAGGGCGGCATCTCGACGTTTCTCGGACTCATGGCGCCTGGCTTCCCCAACGCGTTT
CTGCTGTACGGGCCGCAGGCGCCCACGTCGCTGGTCAACGCGCCGCCGCTGCTGGAACTGCAGGTGGAGTGGGTT
GCACGAGTGCTGGAGGAGATGAAGCGGAGGGGGATGGCGTGCATCGACGTGAGGGAAAGGGCGGCGGCAGAGTGG
TCGCAAAAGACGTGGGCGGCGTTTAACGCCACGCTGAGCAGGGAGACGGGGTCGTGGTGGACGGGGGAGAATATC
CCGGGCAAGAAGCGCGAGCCGCTGATTTGGTTTGGCGGGATGCGCGGGTGGTGGAGGGAGTGCGAGAGGGCGTTG
GAGAATTGGGGTGATTTTGTCGTCGATGGCTAG
Gene >OphauG2|1203
ATGGGCAGCTCAGAGGACAAAATCGTGGTCGACGTGATTGTGGTGGGCGCCGGGTTTGGAGGATGCTACGCCCTC
CATCATCTGCGGGCCCAGGGCTACTCGACAAAGGTTCTCGAAGCTGGCAGCGGGCTGGGAGGAGTGTGGCACTTT
AACCGGTACCCTGGATGTCGAGTTGATTCCGAAGCTCCCGTCTATCAACTGAGCTTGCCGCAGGCGTGGGCGACG
TTTGATTTCAAGGACCGGTATCCCGCGCGAGAGGAGCTTGAGAATTACTTTGGCCACTTGGATAAGACGCTTCAA
CTAGGCAAGGACGTGATATTCAACGCCAGGGTGGCCAGGGCGGAATATGACGCGGGGAAAAACACGTGGGAGTTT
TGCACGCAAGACGGACTGAAAGCGACGGGTCGATACGCCGTGTTTGCCTGTGGCACAACACACAAGGCTTACATT
CCCGAGTTTAAGAAGCTAGACGAGTACAAAGGGCTGGTGATTCACCCTTCGCGGTGGCCGCAAGACGTGAATGTC
AAGGGCAAGAAAATCGGGATAATCGGACAAGGCGCGTCGGCACTGCAAATCATCCAAGACGTTGCCAAGCAGGAG
TGTGAGTTGACGGTGTTTATCCGCACGCCTTGCAACGCGTTTCCCATGGGCGCGCGATCGATTCAGGAATCAAAA
GACGAGTACCAAGAGGCGTTTGACAAGGCCAAGAAGCAAAGCGAGCAGGGCTATGCCATTGATGCGTTTCCTGTT
TCCTACCATGGGGCCACGGCTCAGCAACGGCGGCATCACTACGAGCAGCTTTGGGCTCGGGGCGGATACGGCGTG
TTTATGAGCAACTACTACGACATTCTGCTCGACAAGGAAGCAAATGGCGACTTTTATGCGTTTTGGGCAGCCAAA
GTGCGGGCTCGAATGTCGGATCCCGTCAAGCGCGACATTGTGGCGCCGCTCAAACAGAGTCAATGGATTGGCACA
AAACGAGCGACTCTGGAATGCGACTACTACGAAATGCTGGACCGGGCCAACGTGAAACTCGTCAATCTCAAAAAG
ACGCCCATGACGCAGTTTTGCAGCGCCGGCATCATGGTCGACGACGCTGCGCAGCCCGTCCACGAGCTCGACATT
GTCATCCTGGCCACTGGATACGACGCTGTCACCGGCAGTCTGTACGACACGCACATCCACGGGCGGGACGGCGTC
TCGCTGCAGGAGAAATGGCAGGGCGGCATCTCGACGTTTCTCGGACTCATGGCGCCTGGCTTCCCCAACGCGTTT
CTGCTGTACGGGCCGCAGGCGCCCACGTCGCTGGTCAACGCGCCGCCGCTGCTGGAACTGCAGGTGGAGTGGGTT
GCACGAGTGCTGGAGGAGATGAAGCGGAGGGGGATGGCGTGCATCGACGTGAGGGAAAGGGCGGCGGCAGAGTGG
TCGCAAAAGACGTGGGCGGCGTTTAACGCCACGCTGAGCAGGGAGACGGGGTCGTGGTGGACGGGGGAGAATATC
CCGGGCAAGAAGCGCGAGCCGCTGATTTGGTTTGGCGGGATGCGCGGGTGGTGGAGGGAGTGCGAGAGGGCGTTG
GAGAATTGGGGTGATTTTGTCGTCGATGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail