Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1200
Gene name
LocationContig_1344:47..2322
Strand-
Gene length (bp)2275
Transcript length (bp)1974
Coding sequence length (bp)1974
Protein length (aa) 658

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 199 363 1.0E-07
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 199 359 9.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1200
MRRFGLAALLGGVLFPPASAYLRCEEFDCFEDMVLLEGSRHRLLQQCYHGIYAGEADVASFCGDACAQLHCKRRD
SIYIERTQFRPVCECLIERHKEQSNCDSMPCYKDFVAMSNNSIETFRINCKKYPSYFSSEEGVIVSKDHFPTPPT
CGTPVQNGDAYMFHHGEYHPVCDCLNSRLAAYWPWSDYVISRQDNYRLITLNVFLHVILSSKTAFEEYATAEFVQ
ELAQAVFAQIVAPFNHTLIKFNVITTEVVVNNIWASGYDNENMRRGLHLGDSRDLNFYLISDIGPYGARAAPLEA
KKGIYCTPPPESLLWEIENIGDVALDGCIFSVPSEAAMNRTSLEVQRWMGACDYGPGSCRTQITPLQISNIHHRL
AKTRMVPLDRIARGAHSHIKGEDLRKDPCSNLPCHRELHHIVKGQKPLQTHCRWFEDIEPIEAPEGPGLRSHVPG
MWFENVDLPWWPNNCPHPVQDRLKIPWPTHQNICDCVLGNSRQSPRHTAAINIIKDVDNEIPILVDVFIHVIASS
NDSIMAAKEIFNFYRLANITFIIKAVDLIVNSDWAAGQDHNQMRQVAYMGTSRDLNLFYIDTDTLDGSARSPSSP
IVMCSYPFTSWWARLTKTEPEHDGCLIARNASRNPSRDPASTLRRPTPPKAVLSHII*
Coding >OphauG2|1200
ATGCGGCGGTTCGGCCTCGCCGCCCTCTTGGGCGGCGTCTTGTTCCCCCCTGCTAGCGCTTATTTACGTTGCGAA
GAATTTGACTGCTTCGAAGACATGGTGCTGCTAGAAGGCTCTCGGCACCGTCTTCTACAACAGTGCTACCACGGC
ATCTACGCCGGAGAAGCCGACGTCGCGTCGTTCTGTGGAGACGCTTGTGCACAACTGCACTGCAAACGTAGAGAC
AGCATCTACATCGAGCGTACCCAGTTTCGCCCCGTGTGCGAATGCCTCATTGAACGCCACAAAGAGCAAAGCAAC
TGTGACTCCATGCCTTGCTACAAAGACTTTGTCGCCATGTCTAACAACTCAATAGAAACTTTTCGCATCAACTGC
AAAAAGTACCCTTCATACTTTAGCTCCGAAGAGGGCGTTATAGTGTCAAAGGATCATTTCCCCACGCCCCCTACA
TGTGGCACGCCCGTTCAAAATGGCGATGCCTACATGTTTCATCATGGCGAATATCATCCAGTCTGCGATTGCCTC
AACTCAAGGCTTGCTGCCTATTGGCCCTGGTCGGACTATGTTATTTCCCGGCAAGATAACTATAGGCTCATCACC
CTCAATGTCTTTTTACACGTTATATTATCCAGCAAAACCGCCTTTGAAGAATACGCAACTGCTGAATTCGTACAA
GAGTTGGCCCAGGCAGTCTTTGCCCAAATCGTTGCCCCCTTTAACCACACGCTCATCAAGTTTAACGTAATAACA
ACAGAAGTCGTCGTCAACAACATATGGGCTTCAGGCTACGATAACGAGAATATGCGACGAGGTCTGCATCTCGGG
GATTCGCGCGACCTCAACTTCTATCTCATCAGCGACATTGGTCCCTATGGCGCCCGGGCTGCCCCTCTTGAAGCC
AAGAAAGGCATCTACTGCACCCCTCCGCCAGAATCCCTGCTGTGGGAAATCGAGAATATCGGAGACGTTGCTCTC
GACGGCTGCATCTTCTCAGTCCCCAGCGAGGCTGCCATGAACCGCACCTCTCTGGAAGTCCAACGCTGGATGGGC
GCATGCGACTACGGCCCCGGGTCTTGCCGGACTCAAATCACCCCTCTCCAAATCAGCAATATTCACCATCGACTA
GCCAAAACGCGCATGGTGCCCCTCGACAGAATCGCAAGAGGCGCCCACAGCCACATCAAGGGTGAGGACCTCCGC
AAGGACCCTTGCTCAAACCTGCCTTGCCATCGCGAACTTCACCACATAGTCAAGGGCCAAAAGCCTCTTCAGACC
CACTGCCGCTGGTTCGAAGATATCGAGCCCATCGAGGCACCCGAAGGCCCGGGCCTACGCTCCCACGTTCCAGGC
ATGTGGTTTGAAAATGTCGATCTCCCCTGGTGGCCCAACAATTGCCCCCACCCCGTACAGGACCGCTTGAAAATC
CCCTGGCCTACCCACCAAAACATCTGCGACTGCGTCCTCGGCAACAGCAGACAGTCTCCGCGCCACACTGCTGCC
ATTAACATCATCAAGGATGTCGATAACGAAATACCAATCCTCGTCGACGTCTTTATCCATGTCATCGCCTCCTCA
AATGACAGCATAATGGCTGCAAAGGAGATTTTCAACTTTTACAGACTCGCCAATATCACCTTTATCATCAAAGCC
GTTGATCTCATCGTCAACTCTGATTGGGCCGCCGGCCAAGACCATAACCAGATGCGACAGGTCGCTTACATGGGA
ACCAGCAGAGACCTCAACCTCTTCTATATAGATACTGACACCTTGGACGGCTCTGCCCGATCGCCTTCTTCCCCC
ATCGTCATGTGTTCCTATCCCTTTACCTCGTGGTGGGCAAGACTAACCAAGACCGAACCCGAACACGATGGCTGT
CTTATTGCCAGGAATGCGTCCAGAAACCCGTCGCGAGATCCTGCAAGTACGTTGCGTCGTCCAACACCCCCAAAA
GCTGTCTTGTCGCACATAATCTAA
Transcript >OphauG2|1200
ATGCGGCGGTTCGGCCTCGCCGCCCTCTTGGGCGGCGTCTTGTTCCCCCCTGCTAGCGCTTATTTACGTTGCGAA
GAATTTGACTGCTTCGAAGACATGGTGCTGCTAGAAGGCTCTCGGCACCGTCTTCTACAACAGTGCTACCACGGC
ATCTACGCCGGAGAAGCCGACGTCGCGTCGTTCTGTGGAGACGCTTGTGCACAACTGCACTGCAAACGTAGAGAC
AGCATCTACATCGAGCGTACCCAGTTTCGCCCCGTGTGCGAATGCCTCATTGAACGCCACAAAGAGCAAAGCAAC
TGTGACTCCATGCCTTGCTACAAAGACTTTGTCGCCATGTCTAACAACTCAATAGAAACTTTTCGCATCAACTGC
AAAAAGTACCCTTCATACTTTAGCTCCGAAGAGGGCGTTATAGTGTCAAAGGATCATTTCCCCACGCCCCCTACA
TGTGGCACGCCCGTTCAAAATGGCGATGCCTACATGTTTCATCATGGCGAATATCATCCAGTCTGCGATTGCCTC
AACTCAAGGCTTGCTGCCTATTGGCCCTGGTCGGACTATGTTATTTCCCGGCAAGATAACTATAGGCTCATCACC
CTCAATGTCTTTTTACACGTTATATTATCCAGCAAAACCGCCTTTGAAGAATACGCAACTGCTGAATTCGTACAA
GAGTTGGCCCAGGCAGTCTTTGCCCAAATCGTTGCCCCCTTTAACCACACGCTCATCAAGTTTAACGTAATAACA
ACAGAAGTCGTCGTCAACAACATATGGGCTTCAGGCTACGATAACGAGAATATGCGACGAGGTCTGCATCTCGGG
GATTCGCGCGACCTCAACTTCTATCTCATCAGCGACATTGGTCCCTATGGCGCCCGGGCTGCCCCTCTTGAAGCC
AAGAAAGGCATCTACTGCACCCCTCCGCCAGAATCCCTGCTGTGGGAAATCGAGAATATCGGAGACGTTGCTCTC
GACGGCTGCATCTTCTCAGTCCCCAGCGAGGCTGCCATGAACCGCACCTCTCTGGAAGTCCAACGCTGGATGGGC
GCATGCGACTACGGCCCCGGGTCTTGCCGGACTCAAATCACCCCTCTCCAAATCAGCAATATTCACCATCGACTA
GCCAAAACGCGCATGGTGCCCCTCGACAGAATCGCAAGAGGCGCCCACAGCCACATCAAGGGTGAGGACCTCCGC
AAGGACCCTTGCTCAAACCTGCCTTGCCATCGCGAACTTCACCACATAGTCAAGGGCCAAAAGCCTCTTCAGACC
CACTGCCGCTGGTTCGAAGATATCGAGCCCATCGAGGCACCCGAAGGCCCGGGCCTACGCTCCCACGTTCCAGGC
ATGTGGTTTGAAAATGTCGATCTCCCCTGGTGGCCCAACAATTGCCCCCACCCCGTACAGGACCGCTTGAAAATC
CCCTGGCCTACCCACCAAAACATCTGCGACTGCGTCCTCGGCAACAGCAGACAGTCTCCGCGCCACACTGCTGCC
ATTAACATCATCAAGGATGTCGATAACGAAATACCAATCCTCGTCGACGTCTTTATCCATGTCATCGCCTCCTCA
AATGACAGCATAATGGCTGCAAAGGAGATTTTCAACTTTTACAGACTCGCCAATATCACCTTTATCATCAAAGCC
GTTGATCTCATCGTCAACTCTGATTGGGCCGCCGGCCAAGACCATAACCAGATGCGACAGGTCGCTTACATGGGA
ACCAGCAGAGACCTCAACCTCTTCTATATAGATACTGACACCTTGGACGGCTCTGCCCGATCGCCTTCTTCCCCC
ATCGTCATGTGTTCCTATCCCTTTACCTCGTGGTGGGCAAGACTAACCAAGACCGAACCCGAACACGATGGCTGT
CTTATTGCCAGGAATGCGTCCAGAAACCCGTCGCGAGATCCTGCAAGTACGTTGCGTCGTCCAACACCCCCAAAA
GCTGTCTTGTCGCACATAATCTAA
Gene >OphauG2|1200
ATGCGGCGGTTCGGCCTCGCCGCCCTCTTGGGCGGCGTCTTGTTCCCCCCTGCTAGCGCTTATTTACGTTGCGAA
GAATTTGACTGCTTCGAAGACATGGTGCTGCTAGAAGGCTCTCGGCACCGTCTTCTACAACAGTGCTACCACGGC
ATCTACGCCGGAGAAGCCGACGTCGCGTCGTTCTGTGGAGACGCTTGTGCACAACTGCACTGCAAACGTAGAGAC
AGCATCTACATCGAGCGTACCCAGTTTCGCCCCGTGTGCGAATGCCTCATTGAACGCCACAAAGAGCAAAGCAAC
TGTGACTCCATGCCTTGCTACAAAGACTTTGTCGCCATGTCTAACAACTCAATAGAAACTTTTCGCATCAACTGC
AAAAAGTACCCTTCATACTTTAGCTCCGAAGAGGGCGTTATAGTGTCAAAGGATCATTTCCCCACGCCCCCTACA
TGTGGCACGCCCGTTCAAAATGGCGATGCCTACATGTTTCATCATGGCGAATATCATCCAGTCTGCGATTGCCTC
AACTCAAGGCTTGCTGCCTATTGGCCCTGGTCGGACTATGTTATTTCCCGGCAAGATAACTATAGGCTCATCACC
CTCAATGTCTTTTTACACGTTATATTATCCAGCAAAACCGCCTTTGAAGAAGTAAGTCAACCCGTCGACTTGGAC
TTTCACAGAAACTCCCCCTCCCGCTGACCTTTTGCCGCGCAAATCACACCAGTACGCAACTGCTGAATTCGTACA
AGAGTTGGCCCAGGCAGTCTTTGCCCAAATCGTTGCCCCCTTTAACCACACGCTCATCAAGTTTAACGTAATAAC
AACAGAAGTCGTCGTCAACAACATATGGGCTTCAGGCTACGATAACGAGAATATGCGACGAGGTCTGCATCTCGG
GGATTCGCGCGACCTCAACTTCTATCTCATCAGCGACATTGGTCCCTATGGCGCCCGGGCTGCCCCTCTTGAAGC
CAAGAAAGGCATCTACTGCACCCCTCCGCCAGAATCCCTGCTGTGGGAAATCGAGAATATCGGAGACGTTGCTCT
CGACGGCTGCATCTTCTCAGTCCCCAGCGAGGCTGCCATGAACCGCACCTCTCTGGAAGTCCAACGCTGGATGGG
CGCATGCGACTACGGCCCCGGGTAACCCATACCTCCCGCTTCAGCCCTCAACATGATCCAGCCCACTAACACAAG
CCTCCAGGTCTTGCCGGACTCAAATCACCCCTCTCCAAATCAGCAATATTCACCATCGACTAGCCAAAACGCGCA
TGGTGCCCCTCGACAGAATCGCAAGAGGCGCCCACAGCCACATCAAGGGTGAGGACCTCCGCAAGGACCCTTGCT
CAAACCTGCCTTGCCATCGCGAACTTCACCACATAGTCAAGGGCCAAAAGCCTCTTCAGACCCACTGCCGCTGGT
TCGAAGATATCGAGCCCATCGAGGCACCCGAAGGCCCGGGCCTACGCTCCCACGTTCCAGGCATGTGGTTTGAAA
ATGTCGATCTCCCCTGGTGGCCCAACAATTGCCCCCACCCCGTACAGGACCGCTTGAAAATCCCCTGGCCTACCC
ACCAAAACATCTGCGACTGCGTCCTCGGCAACAGCAGACAGTCTCCGCGCCACACTGCTGCCATTAACATCATCA
AGGATGTCGATAACGAAATACCAATCCTCGTCGACGTCTTTATCCATGTCATCGCCTCCTCAAATGACAGCATAA
TGGCTGCAAAGGTTTGCCTCTCCAAATGCCCCCCCCCCCCCCCCAAGACTAAAAAAGACAAACCATGCCCGGCTC
ACATGTCCCCGCCCCAAAAAGTTCTACAGTACTGGATTGTACGACTACGAAGCGCAGGAGATTTTCAACTTTTAC
AGACTCGCCAATATCACCTTTATCATCAAAGCCGTTGATCTCATCGTCAACTCTGATTGGGCCGCCGGCCAAGAC
CATAACCAGATGCGACAGGTCGCTTACATGGGAACCAGCAGAGACCTCAACCTCTTCTATATAGATACTGACACC
TTGGACGGCTCTGCCCGATCGCCTTCTTCCCCCATCGTCATGTGTTCCTATCCCTTTACCTCGTGGTGGGCAAGA
CTAACCAAGACCGAACCCGAACACGATGGCTGTCTTATTGCCAGGAATGTATCCGCCGGCATGATAGCAAGCGCT
CTACAATACTGGATAGGCGTCCAGAAACCCGTCGCGAGATCCTGCAAGTACGTTGCGTCGTCCAACACCCCCAAA
AGCTGTCTTGTCGCACATAATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail