Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1197
Gene name
LocationContig_1341:1977..4361
Strand+
Gene length (bp)2384
Transcript length (bp)2139
Coding sequence length (bp)2139
Protein length (aa) 713

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 24 281 2.0E-06
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 24 289 2.0E-06
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 24 281 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1197
MTPISLALAMAFAISSSRVVATDWMLNESIDGSSFLNKFQVVQNSEVLNDLGHAHLASKAISGIHIGLNDSSETL
LESSTWTSKKSFQEGLMIARFPRVPQPMCGITSYITLTSSQDSRVSMYEASGSKNNSGVTAYSNGEQCIMESKCS
RANHQCVSSDETWTRPPEARIYAVEWTRESLRLWTWPSKDAPRDINDANPNPQAWGAAVFDMNKTSCAIQSFLPA
MKLQLGISVDHSLDDPTKWRQGCAQSTGYSSRQRYFESHPEALHEQYFHLEHVQWFTDSRASGKTFKPHLVRASR
PRKQPLTSQADDEAVLEKRQSLISTPVSPPPDAVPQASLSESSSTETSAALLSGPHLTSLMSESSHPASSGSAPE
NSLSKPLPPPVPVHENTTTSTAPGLNQPVSQAQGESREDNKEKSEEESEXXXXXXXXXXXXXXXESEEESQEESQ
EENQEESQEESQEESQEESEEESEEEGQEESQEEKPPAVAPGILPPGPSNSTLPGPVIMIRLGGSGSSKAPSLAS
PSSTDRIAASNGTAPSHAAASNHALASHAAASNDTLASHAAAFNDTLPSHAAASNDTLPNHTASSNDALPSHVAS
SNGTLPSHVVLSTSQNNNSPTTSISPLSASTASSSVEASQTFMTTLAAPVATPFTNSSRNFTIGNSASTPKKPLR
VALHPSSEAASDLAKGSEGSETTAGEVKSALMHQRRH*
Coding >OphauG2|1197
ATGACTCCCATCAGCCTGGCCCTGGCCATGGCTTTTGCCATCTCCTCGAGCCGAGTAGTCGCTACAGACTGGATG
CTCAACGAAAGCATAGATGGCTCTTCTTTCTTGAACAAATTCCAAGTCGTTCAGAACTCTGAAGTTTTGAACGAC
CTTGGCCACGCTCACTTGGCCTCAAAAGCCATCTCGGGTATTCACATAGGGCTCAACGACTCATCAGAAACTTTG
CTCGAAAGCTCAACTTGGACATCCAAAAAGTCGTTTCAAGAAGGACTCATGATTGCGAGATTTCCACGAGTGCCG
CAGCCCATGTGCGGCATTACGTCTTACATCACATTGACCAGTTCTCAAGACAGCCGAGTCTCCATGTATGAAGCC
AGTGGCAGCAAGAATAACAGTGGTGTTACGGCCTACTCCAACGGCGAACAATGCATCATGGAGAGCAAATGCAGT
CGAGCCAATCATCAATGTGTCTCATCTGATGAGACATGGACAAGGCCTCCTGAGGCCCGAATCTACGCGGTGGAA
TGGACTCGAGAGAGCCTGAGATTATGGACATGGCCAAGTAAAGATGCGCCTCGAGACATCAACGATGCCAACCCG
AATCCCCAGGCTTGGGGCGCTGCTGTCTTTGACATGAACAAGACGTCGTGTGCCATCCAGAGCTTCTTGCCGGCC
ATGAAGCTGCAGCTTGGCATCAGCGTCGATCACAGCCTGGACGACCCGACAAAGTGGCGCCAAGGCTGCGCCCAG
TCGACGGGCTACTCTTCGCGCCAGAGATATTTTGAAAGCCACCCCGAGGCGCTCCATGAGCAATATTTCCATCTT
GAACATGTTCAGTGGTTCACAGACAGCAGAGCGTCGGGCAAGACATTCAAACCACATCTGGTACGCGCCTCGAGG
CCCCGGAAACAGCCCTTGACGTCTCAGGCAGATGATGAAGCTGTCTTGGAGAAGCGACAATCCCTCATCTCGACA
CCCGTCTCGCCTCCACCAGATGCGGTTCCCCAAGCATCATTGTCCGAGTCTTCATCCACGGAAACCTCGGCAGCC
TTGCTATCTGGACCGCATCTCACGTCTCTCATGTCAGAGTCGTCTCATCCAGCTTCATCTGGCTCTGCTCCTGAA
AACTCTTTATCCAAGCCTCTGCCGCCACCAGTTCCGGTTCATGAGAATACGACAACGTCTACTGCGCCGGGTTTG
AATCAGCCAGTCTCCCAGGCACAAGGCGAGAGTCGGGAGGATAATAAAGAAAAGAGTGAAGAGGAGAGTGAANNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAGAGTGAAGAGGAGAGTCAGGAGGAGAGTCAA
GAGGAGAACCAAGAGGAGAGTCAAGAGGAGAGCCAAGAGGAGAGCCAAGAGGAGAGTGAAGAGGAGAGTGAAGAG
GAGGGTCAGGAGGAGAGCCAAGAGGAAAAGCCTCCAGCAGTTGCCCCTGGCATCCTGCCACCAGGTCCTTCCAAT
TCGACTCTGCCCGGCCCTGTCATCATGATCCGTCTTGGGGGCAGTGGCTCTTCAAAGGCACCCTCTTTGGCATCT
CCATCCTCAACCGACCGTATAGCCGCTTCCAATGGCACTGCACCCAGCCATGCTGCCGCTTCCAACCATGCTCTT
GCCAGCCATGCTGCCGCTTCCAACGACACTCTTGCCAGCCATGCTGCCGCTTTCAACGACACTCTTCCCAGTCAT
GCTGCCGCTTCCAACGACACTCTTCCCAACCATACTGCCTCTTCCAACGATGCTCTTCCCAGTCACGTTGCCTCT
TCCAATGGCACACTTCCCAGTCATGTTGTTCTCAGCACTTCTCAAAACAACAACTCGCCAACCACGTCAATTAGC
CCTTTGTCCGCCTCGACGGCCTCGTCCAGCGTCGAGGCTTCTCAAACATTCATGACGACTCTGGCTGCTCCCGTC
GCGACTCCTTTTACCAACTCGAGCAGAAACTTTACTATTGGCAACAGTGCTTCCACGCCCAAGAAGCCTCTGAGA
GTAGCGTTGCATCCCAGCAGTGAAGCAGCTTCTGATTTGGCCAAGGGCTCGGAGGGTTCTGAGACGACGGCTGGC
GAGGTCAAATCGGCTTTGATGCATCAGAGACGCCATTAG
Transcript >OphauG2|1197
ATGACTCCCATCAGCCTGGCCCTGGCCATGGCTTTTGCCATCTCCTCGAGCCGAGTAGTCGCTACAGACTGGATG
CTCAACGAAAGCATAGATGGCTCTTCTTTCTTGAACAAATTCCAAGTCGTTCAGAACTCTGAAGTTTTGAACGAC
CTTGGCCACGCTCACTTGGCCTCAAAAGCCATCTCGGGTATTCACATAGGGCTCAACGACTCATCAGAAACTTTG
CTCGAAAGCTCAACTTGGACATCCAAAAAGTCGTTTCAAGAAGGACTCATGATTGCGAGATTTCCACGAGTGCCG
CAGCCCATGTGCGGCATTACGTCTTACATCACATTGACCAGTTCTCAAGACAGCCGAGTCTCCATGTATGAAGCC
AGTGGCAGCAAGAATAACAGTGGTGTTACGGCCTACTCCAACGGCGAACAATGCATCATGGAGAGCAAATGCAGT
CGAGCCAATCATCAATGTGTCTCATCTGATGAGACATGGACAAGGCCTCCTGAGGCCCGAATCTACGCGGTGGAA
TGGACTCGAGAGAGCCTGAGATTATGGACATGGCCAAGTAAAGATGCGCCTCGAGACATCAACGATGCCAACCCG
AATCCCCAGGCTTGGGGCGCTGCTGTCTTTGACATGAACAAGACGTCGTGTGCCATCCAGAGCTTCTTGCCGGCC
ATGAAGCTGCAGCTTGGCATCAGCGTCGATCACAGCCTGGACGACCCGACAAAGTGGCGCCAAGGCTGCGCCCAG
TCGACGGGCTACTCTTCGCGCCAGAGATATTTTGAAAGCCACCCCGAGGCGCTCCATGAGCAATATTTCCATCTT
GAACATGTTCAGTGGTTCACAGACAGCAGAGCGTCGGGCAAGACATTCAAACCACATCTGGTACGCGCCTCGAGG
CCCCGGAAACAGCCCTTGACGTCTCAGGCAGATGATGAAGCTGTCTTGGAGAAGCGACAATCCCTCATCTCGACA
CCCGTCTCGCCTCCACCAGATGCGGTTCCCCAAGCATCATTGTCCGAGTCTTCATCCACGGAAACCTCGGCAGCC
TTGCTATCTGGACCGCATCTCACGTCTCTCATGTCAGAGTCGTCTCATCCAGCTTCATCTGGCTCTGCTCCTGAA
AACTCTTTATCCAAGCCTCTGCCGCCACCAGTTCCGGTTCATGAGAATACGACAACGTCTACTGCGCCGGGTTTG
AATCAGCCAGTCTCCCAGGCACAAGGCGAGAGTCGGGAGGATAATAAAGAAAAGAGTGAAGAGGAGAGTGAANNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAGAGTGAAGAGGAGAGTCAGGAGGAGAGTCAA
GAGGAGAACCAAGAGGAGAGTCAAGAGGAGAGCCAAGAGGAGAGCCAAGAGGAGAGTGAAGAGGAGAGTGAAGAG
GAGGGTCAGGAGGAGAGCCAAGAGGAAAAGCCTCCAGCAGTTGCCCCTGGCATCCTGCCACCAGGTCCTTCCAAT
TCGACTCTGCCCGGCCCTGTCATCATGATCCGTCTTGGGGGCAGTGGCTCTTCAAAGGCACCCTCTTTGGCATCT
CCATCCTCAACCGACCGTATAGCCGCTTCCAATGGCACTGCACCCAGCCATGCTGCCGCTTCCAACCATGCTCTT
GCCAGCCATGCTGCCGCTTCCAACGACACTCTTGCCAGCCATGCTGCCGCTTTCAACGACACTCTTCCCAGTCAT
GCTGCCGCTTCCAACGACACTCTTCCCAACCATACTGCCTCTTCCAACGATGCTCTTCCCAGTCACGTTGCCTCT
TCCAATGGCACACTTCCCAGTCATGTTGTTCTCAGCACTTCTCAAAACAACAACTCGCCAACCACGTCAATTAGC
CCTTTGTCCGCCTCGACGGCCTCGTCCAGCGTCGAGGCTTCTCAAACATTCATGACGACTCTGGCTGCTCCCGTC
GCGACTCCTTTTACCAACTCGAGCAGAAACTTTACTATTGGCAACAGTGCTTCCACGCCCAAGAAGCCTCTGAGA
GTAGCGTTGCATCCCAGCAGTGAAGCAGCTTCTGATTTGGCCAAGGGCTCGGAGGGTTCTGAGACGACGGCTGGC
GAGGTCAAATCGGCTTTGATGCATCAGAGACGCCATTAG
Gene >OphauG2|1197
ATGACTCCCATCAGCCTGGCCCTGGCCATGGCTTTTGCCATCTCCTCGAGCCGAGTAGTCGCTACAGACTGGATG
CTCAACGAAAGCATAGATGGCTCTTCTTTCTTGAACAAATTCCAAGTCGTTCAGGTAAGCCGAGGCGTGGTGTCT
AGTTGTATGCTTGGAGCGAAGCGCTAAGATGATTAGAACTCTGAAGTTTTGAACGACCTTGGCCACGCTCACTTG
GCCTCAAAAGCCATCTCGGGTATTCACATAGGGCTCAACGACTCATCAGAAACTTTGCTCGAAAGCTCAACTTGG
ACATCCAAAAAGTCGTTTCAAGAAGGACTCATGATTGCGAGATTTCCACGAGTGCCGCAGCCCATGTGCGGCATT
ACGTCTTACATGTAAGTGAATGGCTCAATGCTGAAACTGTCATGGTGGTGCCAGGCTTGCTCACTAGCATTGTCT
AGCACATTGACCAGTTCTCAAGACAGCCGAGTCTCCATGTATGAAGCCAGTGGCAGCAAGAATAACAGTGGTGTT
ACGGCCTACTCCAACGGCGAACAATGCATCATGGAGAGCAAATGCAGTCGAGCCAATCATCAATGTGTCTCATCT
GATGAGACATGGACAAGGCCTCCTGAGGCCCGAATCTGTAAGTCTTTGCACCCATCATTAATGTCTCGGATTCTG
AGCTTCCACAATCTAATCTGAGACAGACGCGGTGGAATGGACTCGAGAGAGCCTGAGATTATGGACATGGCCAAG
TAAAGATGCGCCTCGAGACATCAACGATGCCAACCCGAATCCCCAGGCTTGGGGCGCTGCTGTCTTTGACATGAA
CAAGACGTCGTGTGCCATCCAGAGCTTCTTGCCGGCCATGAAGCTGCAGCTTGGCATCAGCGTCGATCACAGCCT
GGACGACCCGACAAAGTGGCGCCAAGGCTGCGCCCAGTCGACGGGCTACTCTTCGCGCCAGAGATATTTTGAAAG
CCACCCCGAGGCGCTCCATGAGCAATATTTCCATCTTGAACATGTTCAGTGGTTCACAGACAGCAGAGCGTCGGG
CAAGACATTCAAACCACATCTGGTACGCGCCTCGAGGCCCCGGAAACAGCCCTTGACGTCTCAGGCAGATGATGA
AGCTGTCTTGGAGAAGCGACAATCCCTCATCTCGACACCCGTCTCGCCTCCACCAGATGCGGTTCCCCAAGCATC
ATTGTCCGAGTCTTCATCCACGGAAACCTCGGCAGCCTTGCTATCTGGACCGCATCTCACGTCTCTCATGTCAGA
GTCGTCTCATCCAGCTTCATCTGGCTCTGCTCCTGAAAACTCTTTATCCAAGCCTCTGCCGCCACCAGTTCCGGT
TCATGAGAATACGACAACGTCTACTGCGCCGGGTTTGAATCAGCCAGTCTCCCAGGCACAAGGCGAGAGTCGGGA
GGATAATAAAGAAAAGAGTGAAGAGGAGAGTGAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNAGGAGAGTGAAGAGGAGAGTCAGGAGGAGAGTCAAGAGGAGAACCAAGAGGAGAGTCAAGAGGAGAGCCAAGA
GGAGAGCCAAGAGGAGAGTGAAGAGGAGAGTGAAGAGGAGGGTCAGGAGGAGAGCCAAGAGGAAAAGCCTCCAGC
AGTTGCCCCTGGCATCCTGCCACCAGGTCCTTCCAATTCGACTCTGCCCGGCCCTGTCATCATGATCCGTCTTGG
GGGCAGTGGCTCTTCAAAGGCACCCTCTTTGGCATCTCCATCCTCAACCGACCGTATAGCCGCTTCCAATGGCAC
TGCACCCAGCCATGCTGCCGCTTCCAACCATGCTCTTGCCAGCCATGCTGCCGCTTCCAACGACACTCTTGCCAG
CCATGCTGCCGCTTTCAACGACACTCTTCCCAGTCATGCTGCCGCTTCCAACGACACTCTTCCCAACCATACTGC
CTCTTCCAACGATGCTCTTCCCAGTCACGTTGCCTCTTCCAATGGCACACTTCCCAGTCATGTTGTTCTCAGCAC
TTCTCAAAACAACAACTCGCCAACCACGTCAATTAGCCCTTTGTCCGCCTCGACGGCCTCGTCCAGCGTCGAGGC
TTCTCAAACATTCATGACGACTCTGGCTGCTCCCGTCGCGACTCCTTTTACCAACTCGAGCAGAAACTTTACTAT
TGGCAACAGTGCTTCCACGCCCAAGAAGCCTCTGAGAGTAGCGTTGCATCCCAGCAGTGAAGCAGCTTCTGATTT
GGCCAAGGGCTCGGAGGGTTCTGAGACGACGGCTGGCGAGGTCAAATCGGCTTTGTCTGCTACTGCCGCTGGAGG
CTTGGTTACTGCAGCCTCGTCTGGAGATGTGGTGGAGGATGCATCAGAGACGCCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail