Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|119
Gene name
LocationContig_1010:1789..4854
Strand-
Gene length (bp)3065
Transcript length (bp)2727
Coding sequence length (bp)2727
Protein length (aa) 909

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 1.9E-18 320 824
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 8.8E-08 44 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 39 77 7.0E-15
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 39 76 2.0E-13
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 45 76 5.0E-09
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 40 76 9.0E-09
sp|Q5A4F3|AHR1_CANAL Adhesion and hyphal regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AHR1 PE=1 SV=1 32 73 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 39 77 7.0E-15
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 39 76 2.0E-13
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 45 76 5.0E-09
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 40 76 9.0E-09
sp|Q5A4F3|AHR1_CANAL Adhesion and hyphal regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AHR1 PE=1 SV=1 32 73 4.0E-08
sp|Q59QC7|UPC2_CANAL Sterol uptake control protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UPC2 PE=1 SV=1 40 76 2.0E-06
sp|P05085|ARGR2_YEAST Arginine metabolism regulation protein II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG81 PE=1 SV=3 35 86 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0043169 cation binding No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2401
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|119 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3547
Ophiocordyceps camponoti-floridani Ophcf2|04170
Ophiocordyceps camponoti-rufipedis Ophun1|1227
Ophiocordyceps kimflemingae Ophio5|2137
Ophiocordyceps subramaniannii Hirsu2|3395

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|119
MSDPSGMAPTADTNRPGPRTAPHADDEGDDGKSKKPVVKKRTKTGCLTCRKRRIKCDENKPRCRNCIKSKRECEG
YNQRVVFKDPMNAEHNHFAPAIYAGGNPYIGDALTMAPKLSGPLPLQAIAPKPSPYDFNQPHMANLSASHHNTHH
NQPQHMIHSDALANGDLSASLHSSMPNPLLDAAFAADQVHGAYNVNQNNYFAPRNLQDYAYGTSSSGIPITSSTE
VANLGQPSTESAHVPDSDYDDPLSDDDVNMVSSDDENPSSRTLMAPSTAHLLWPATMNATRVRTFSAFAQERALS
EYMDYAPHSDLRAHAMQVIFTHFVSVTGPSMSLYERDPSPHEEPGQFEGNAQLGHNLFSYTVPVLSLKHPGLLHA
IMAIASLQIAKLQGTPATAALKHYHWSIRRIAKNVRTPLRRTKVSTLAATLLLAYFEVWSSDHMKWCSHLLGARL
LFREIDLREMSRVCLPAKRLKWRSRGGFSRSTSDINYQLLSVITGTRVVAEDYGLQDGQSLDQHYLYVTDRDIEQ
YNTLRDLFWWYAKMDVYQSFLGGTRLFMEYEAWTQCLPRAPISNIHAIYGTYDHVILLLGRLASFTSRDQARKRK
ANRSSNTTAEGSPPQFPGIVPTHGRFRVPMGFSPPMGYSPHTDPNDEAGTPQSLEAAEQEWDSIRQGFEALESSL
GPHFMPLNSEYMDRKETPFGSALHYRTYSVAGIWMNYYMGLIHLYRGRPNMPPAAMQAAQLAAPITARYAIKIGR
IAAGLADDCSQLAEVSTTLAAAFIESCFCLFVAAVQLQNNDQRCWVTQRMYDISRLTGWQSAKKIAVGCEAAWQK
ACQLGHGPEYKRPDHLDDVPVSVWMLPRRRDASMSELSRNDGELNRSEERRLVHVRRLEQTNLAFGLLGVEADLD
RIELADIN*
Coding >OphauG2|119
ATGTCGGACCCGAGCGGCATGGCACCCACGGCGGATACAAATCGGCCAGGGCCGCGCACCGCACCCCATGCTGAT
GATGAGGGCGATGATGGCAAATCAAAAAAGCCAGTAGTCAAGAAGAGAACAAAGACTGGATGTCTCACCTGTCGC
AAGCGGCGCATAAAGTGTGACGAGAACAAGCCAAGATGCAGGAATTGCATCAAGTCCAAGCGCGAATGCGAGGGC
TACAATCAGCGAGTTGTCTTCAAGGATCCCATGAATGCCGAGCACAATCATTTTGCGCCTGCAATCTACGCCGGA
GGTAACCCCTATATTGGGGACGCCCTGACCATGGCTCCCAAGCTTTCTGGACCTCTACCTTTGCAGGCTATTGCG
CCAAAACCCTCGCCGTACGATTTCAACCAGCCACACATGGCAAATTTGTCCGCGAGCCACCATAATACTCATCAC
AACCAGCCACAGCATATGATTCATTCCGACGCCTTGGCAAATGGCGACCTTTCTGCCAGCTTACACTCGTCGATG
CCTAATCCTCTCCTGGATGCCGCTTTTGCGGCTGATCAAGTACATGGCGCTTACAACGTCAATCAGAACAACTAT
TTTGCACCTCGCAATTTACAAGACTACGCTTACGGGACCTCTAGTAGCGGCATCCCCATCACTTCATCTACAGAG
GTTGCCAACCTGGGCCAACCCTCGACCGAGTCTGCGCACGTTCCTGACAGCGATTATGATGACCCTCTGTCAGAC
GACGATGTTAACATGGTCTCCTCTGACGATGAAAACCCAAGTTCTCGCACGCTCATGGCCCCATCTACAGCTCAT
CTTCTCTGGCCTGCGACCATGAATGCAACCCGAGTGAGGACCTTCTCCGCCTTTGCCCAGGAGCGCGCTCTATCC
GAGTACATGGATTATGCACCACATTCTGATCTTCGAGCACATGCGATGCAAGTCATATTTACGCACTTTGTCAGC
GTCACTGGTCCATCCATGTCATTATACGAAAGAGACCCATCTCCTCACGAAGAGCCTGGCCAGTTTGAAGGAAAC
GCACAATTAGGCCACAACTTGTTCAGCTACACTGTCCCAGTCCTGTCCTTGAAACACCCTGGTTTGCTTCATGCT
ATCATGGCAATTGCCAGCTTGCAGATTGCCAAGCTTCAAGGCACACCGGCGACAGCAGCACTCAAGCACTACCAC
TGGTCGATTCGTCGCATTGCAAAAAATGTTAGGACACCATTGAGGAGAACAAAAGTCTCAACGTTGGCTGCAACA
CTCCTTCTCGCATACTTTGAGGTGTGGTCCTCGGATCATATGAAATGGTGTAGCCACCTACTTGGTGCCAGACTC
CTATTCCGCGAAATTGATCTCCGAGAAATGTCTCGAGTATGTCTACCTGCTAAGCGACTAAAGTGGCGCTCCAGA
GGAGGGTTTTCAAGATCCACAAGCGACATCAATTATCAGTTGTTGAGTGTTATTACCGGCACACGAGTGGTAGCA
GAGGACTACGGTCTCCAGGACGGACAGTCGCTCGACCAGCATTATCTATACGTAACAGATAGGGATATCGAGCAG
TATAATACGTTGCGGGACTTGTTCTGGTGGTATGCAAAAATGGATGTGTACCAAAGTTTTTTGGGAGGAACACGA
TTATTTATGGAATATGAGGCATGGACACAATGCCTCCCCCGGGCACCAATATCCAACATACATGCAATCTATGGA
ACATATGATCATGTGATTCTCTTGTTAGGACGCCTTGCTAGCTTCACTTCCAGAGATCAAGCCAGAAAGCGCAAG
GCGAACCGAAGTTCTAACACAACTGCCGAAGGATCACCGCCTCAGTTTCCCGGTATCGTGCCGACTCATGGTCGC
TTTCGCGTTCCAATGGGCTTTAGCCCCCCAATGGGCTACTCTCCGCACACGGACCCCAACGACGAGGCTGGGACG
CCGCAAAGCTTGGAGGCAGCGGAGCAAGAATGGGATAGCATCCGCCAAGGGTTCGAGGCTCTGGAGAGCAGTCTA
GGCCCTCATTTCATGCCATTGAATAGCGAGTACATGGACCGAAAGGAAACACCCTTTGGATCAGCTCTACATTAT
CGCACTTACTCGGTTGCTGGCATTTGGATGAATTACTATATGGGGCTGATTCACTTGTATCGAGGCCGCCCCAAT
ATGCCCCCAGCGGCCATGCAGGCGGCGCAATTGGCAGCTCCTATTACGGCGAGATATGCGATCAAAATTGGGCGC
ATCGCCGCAGGACTGGCTGATGATTGTTCTCAGCTGGCAGAAGTGAGCACAACACTGGCTGCGGCATTTATAGAG
AGCTGCTTTTGTCTATTTGTGGCGGCTGTGCAGCTCCAGAATAATGACCAGCGATGCTGGGTCACTCAGCGCATG
TATGACATCTCGCGTCTCACGGGCTGGCAGTCGGCAAAGAAAATTGCTGTAGGATGCGAAGCGGCTTGGCAAAAG
GCTTGTCAACTTGGTCATGGCCCAGAATACAAGAGGCCTGATCATCTCGACGATGTGCCCGTATCAGTATGGATG
CTGCCTCGGCGTCGTGACGCGAGTATGTCGGAGCTTAGCCGAAACGATGGAGAGCTCAATCGAAGCGAGGAGCGA
CGGTTAGTTCATGTGAGGAGGCTGGAACAGACGAATCTTGCGTTTGGACTCCTGGGAGTTGAGGCAGACTTGGAT
CGCATAGAACTGGCAGACATCAATTGA
Transcript >OphauG2|119
ATGTCGGACCCGAGCGGCATGGCACCCACGGCGGATACAAATCGGCCAGGGCCGCGCACCGCACCCCATGCTGAT
GATGAGGGCGATGATGGCAAATCAAAAAAGCCAGTAGTCAAGAAGAGAACAAAGACTGGATGTCTCACCTGTCGC
AAGCGGCGCATAAAGTGTGACGAGAACAAGCCAAGATGCAGGAATTGCATCAAGTCCAAGCGCGAATGCGAGGGC
TACAATCAGCGAGTTGTCTTCAAGGATCCCATGAATGCCGAGCACAATCATTTTGCGCCTGCAATCTACGCCGGA
GGTAACCCCTATATTGGGGACGCCCTGACCATGGCTCCCAAGCTTTCTGGACCTCTACCTTTGCAGGCTATTGCG
CCAAAACCCTCGCCGTACGATTTCAACCAGCCACACATGGCAAATTTGTCCGCGAGCCACCATAATACTCATCAC
AACCAGCCACAGCATATGATTCATTCCGACGCCTTGGCAAATGGCGACCTTTCTGCCAGCTTACACTCGTCGATG
CCTAATCCTCTCCTGGATGCCGCTTTTGCGGCTGATCAAGTACATGGCGCTTACAACGTCAATCAGAACAACTAT
TTTGCACCTCGCAATTTACAAGACTACGCTTACGGGACCTCTAGTAGCGGCATCCCCATCACTTCATCTACAGAG
GTTGCCAACCTGGGCCAACCCTCGACCGAGTCTGCGCACGTTCCTGACAGCGATTATGATGACCCTCTGTCAGAC
GACGATGTTAACATGGTCTCCTCTGACGATGAAAACCCAAGTTCTCGCACGCTCATGGCCCCATCTACAGCTCAT
CTTCTCTGGCCTGCGACCATGAATGCAACCCGAGTGAGGACCTTCTCCGCCTTTGCCCAGGAGCGCGCTCTATCC
GAGTACATGGATTATGCACCACATTCTGATCTTCGAGCACATGCGATGCAAGTCATATTTACGCACTTTGTCAGC
GTCACTGGTCCATCCATGTCATTATACGAAAGAGACCCATCTCCTCACGAAGAGCCTGGCCAGTTTGAAGGAAAC
GCACAATTAGGCCACAACTTGTTCAGCTACACTGTCCCAGTCCTGTCCTTGAAACACCCTGGTTTGCTTCATGCT
ATCATGGCAATTGCCAGCTTGCAGATTGCCAAGCTTCAAGGCACACCGGCGACAGCAGCACTCAAGCACTACCAC
TGGTCGATTCGTCGCATTGCAAAAAATGTTAGGACACCATTGAGGAGAACAAAAGTCTCAACGTTGGCTGCAACA
CTCCTTCTCGCATACTTTGAGGTGTGGTCCTCGGATCATATGAAATGGTGTAGCCACCTACTTGGTGCCAGACTC
CTATTCCGCGAAATTGATCTCCGAGAAATGTCTCGAGTATGTCTACCTGCTAAGCGACTAAAGTGGCGCTCCAGA
GGAGGGTTTTCAAGATCCACAAGCGACATCAATTATCAGTTGTTGAGTGTTATTACCGGCACACGAGTGGTAGCA
GAGGACTACGGTCTCCAGGACGGACAGTCGCTCGACCAGCATTATCTATACGTAACAGATAGGGATATCGAGCAG
TATAATACGTTGCGGGACTTGTTCTGGTGGTATGCAAAAATGGATGTGTACCAAAGTTTTTTGGGAGGAACACGA
TTATTTATGGAATATGAGGCATGGACACAATGCCTCCCCCGGGCACCAATATCCAACATACATGCAATCTATGGA
ACATATGATCATGTGATTCTCTTGTTAGGACGCCTTGCTAGCTTCACTTCCAGAGATCAAGCCAGAAAGCGCAAG
GCGAACCGAAGTTCTAACACAACTGCCGAAGGATCACCGCCTCAGTTTCCCGGTATCGTGCCGACTCATGGTCGC
TTTCGCGTTCCAATGGGCTTTAGCCCCCCAATGGGCTACTCTCCGCACACGGACCCCAACGACGAGGCTGGGACG
CCGCAAAGCTTGGAGGCAGCGGAGCAAGAATGGGATAGCATCCGCCAAGGGTTCGAGGCTCTGGAGAGCAGTCTA
GGCCCTCATTTCATGCCATTGAATAGCGAGTACATGGACCGAAAGGAAACACCCTTTGGATCAGCTCTACATTAT
CGCACTTACTCGGTTGCTGGCATTTGGATGAATTACTATATGGGGCTGATTCACTTGTATCGAGGCCGCCCCAAT
ATGCCCCCAGCGGCCATGCAGGCGGCGCAATTGGCAGCTCCTATTACGGCGAGATATGCGATCAAAATTGGGCGC
ATCGCCGCAGGACTGGCTGATGATTGTTCTCAGCTGGCAGAAGTGAGCACAACACTGGCTGCGGCATTTATAGAG
AGCTGCTTTTGTCTATTTGTGGCGGCTGTGCAGCTCCAGAATAATGACCAGCGATGCTGGGTCACTCAGCGCATG
TATGACATCTCGCGTCTCACGGGCTGGCAGTCGGCAAAGAAAATTGCTGTAGGATGCGAAGCGGCTTGGCAAAAG
GCTTGTCAACTTGGTCATGGCCCAGAATACAAGAGGCCTGATCATCTCGACGATGTGCCCGTATCAGTATGGATG
CTGCCTCGGCGTCGTGACGCGAGTATGTCGGAGCTTAGCCGAAACGATGGAGAGCTCAATCGAAGCGAGGAGCGA
CGGTTAGTTCATGTGAGGAGGCTGGAACAGACGAATCTTGCGTTTGGACTCCTGGGAGTTGAGGCAGACTTGGAT
CGCATAGAACTGGCAGACATCAATTGA
Gene >OphauG2|119
ATGTCGGACCCGAGCGGCATGGCACCCACGGCGGATACAAATCGGCCAGGGCCGCGCACCGCACCCCATGCTGAT
GATGAGGGCGATGATGGCAAATCAAAAAAGCCAGTAGTCAAGAAGAGAACAAAGACTGGATGTCTCAGTGAGTGC
TCTTGATTCCACCTGGCTGTCATGGCTAACTCAACAACTTCGCAAGCCTGTCGCAAGCGGCGCATAAAGTGTGAC
GAGAACAAGCCAAGATGCAGGAATTGCATCAAGTCCAAGCGCGAATGCGAGGGCTACAATCAGCGAGTTGTCTTC
AAGGATCCCATGAATGCCGAGCACAATCATTTTGCGCCTGCAATCTACGCCGGAGGTAACCCCTATATTGGGGAC
GCCCTGACCATGGCTCCCAAGCTTTCTGGACCTCTACCTTTGCAGGCTATTGCGCCAAAACCCTCGCCGTACGAT
TTCAACCAGCCACACATGGCAAATTTGTCCGCGAGCCACCATAATACTCATCACAACCAGCCACAGCATATGATT
CATTCCGACGCCTTGGCAAATGGCGACCTTTCTGCCAGCTTACACTCGTCGATGCCTAATCCTCTCCTGGATGCC
GCTTTTGCGGCTGATCAAGTACATGGCGCTTACAACGTCAATCAGAACAACTATTTTGCACCTCGCAATTTACAA
GACTACGCTTACGGGACCTCTAGTAGCGGCATCCCCATCACTTCATCTACAGAGGTTGCCAACCTGGGCCAACCC
TCGACCGAGTCTGCGCACGTTCCTGACAGCGATTATGATGACCCTCTGTCAGACGACGATGTTAACATGGTCTCC
TCTGACGATGAAAACCCAAGTTCTCGCACGCTCATGGCCCCATCTACAGCTCATCTTCTCTGGCCTGCGACCATG
AATGCAACCCGAGTGAGGACCTTCTCCGCCTTTGCCCAGGAGCGCGCTCTATCCGAGTACATGGATTATGCACCA
CATTCTGATCTTCGAGCACATGCGATGCAAGTCATATTTACGCACTTTGTCAGCGTCACTGGTCCATCCATGTCA
TTATACGAAAGAGACCCATCTCCTCACGAAGAGCCTGGCCAGTTTGAAGGAAACGCACAATTAGGCCACAACTTG
TTCAGCTGTATGCCTATCCCACTTCGACGAGTTCTGACTGATTTATAATTGCTAACTTGCTTGAATGCAAAGACA
CTGTCCCAGTCCTGTCCTTGAAACACCCTGGTTTGCTTCATGCTATCATGGCAATTGCCAGCTTGCAGATTGCCA
AGCTTCAAGGCACACCGGCGACAGCAGCACTCAAGCACTACCACTGGTCGATTCGTCGCATTGCAAAAAATGTTA
GGACACCATTGAGGAGAACAAAAGTCTCAACGTTGGCTGCAACACTCCTTCTCGCATACTTTGAGGTGTGGTCCT
CGGATCATATGAAATGGTGTAGCCACCTACTTGGTGCCAGACTCCTATTCCGCGAAATTGATCTCCGAGAAATGT
CTCGAGTATGTCTACCTGCTAAGCGACTAAAGTGGCGCTCCAGAGGAGGGTTTTCAAGATCCACAAGCGACATCA
ATTATCAGTTGTTGAGTGTTATTACCGGCACACGAGTGGTAGCAGAGGACTACGGTCTCCAGGACGGACAGTCGC
TCGACCAGCATTATCTATACGTAACAGATAGGGATATCGAGCAGTATAATACGTTGCGGGACTTGTTCTGGTGGT
ATGCAAAAATGGATGTGTACCAAAGTTTTTTGGGAGGAACACGATTATTGTATGTCGATGCTCCAATGCGAAGCA
TTCGGCAAAATACTTTTGCTGACTGATTTGCAGTATGGAATATGAGGCATGGACACAATGCCTCCCCCGGGCACC
AATATCCAACATACATGCAATGTGAGTGGCTAGAATACCCTTTATTCGCTTCTTGGTTTATTTCGCGGACCAAGT
TGTTAACATTGGCGCATCTAAAAGCTATGGAACATATGATCATGTGATTCTCTTGTTAGGACGCCTTGCTAGCTT
CACTTCCAGAGATCAAGCCAGAAAGCGCAAGGCGAACCGAAGTTCTAACACAACTGCCGAAGGATCACCGCCTCA
GTTTCCCGGTATCGTGCCGACTCATGGTCGCTTTCGCGTTCCAATGGGCTTTAGCCCCCCAATGGGCTACTCTCC
GCACACGGACCCCAACGACGAGGCTGGGACGCCGCAAAGCTTGGAGGCAGCGGAGCAAGAATGGGATAGCATCCG
CCAAGGGTTCGAGGCTCTGGAGAGCAGTCTAGGCCCTCATTTCATGCCATTGAATAGCGAGTACATGGACCGAAA
GGAAACACCCTTTGGATCAGCTCTACATTATCGCACTTACTCGGTTGCTGGCATTTGGATGAATTACTATATGGG
GCTGATTCACTTGTATCGAGGCCGCCCCAATATGCCCCCAGCGGCCATGCAGGCGGCGCAATTGGCAGCTCCTAT
TACGGCGAGATATGCGATCAAAATTGGGCGCATCGCCGCAGGACTGGCTGATGATTGTTCTCAGCTGGCAGAAGT
GAGCACAACACTGGCTGCGGCATTTATAGAGAGCTGCTTTTGTCTATTTGTGGCGGCTGTGCAGGTTTGTGACTC
TTGTCCCCCAGACCGTGTCTACCAGGCTTGGGCCGATGGCAAGTTCCCTACTGATAAGGCGTTGGTGGCAGCTCC
AGAATAATGACCAGCGATGCTGGGTCACTCAGCGCATGTATGACATCTCGCGTCTCACGGGCTGGCAGTCGGCAA
AGAAAATTGCTGTAGGATGCGAAGCGGCTTGGCAAAAGGCTTGTCAACTTGGTCATGGCCCAGAATACAAGAGGC
CTGATCATCTCGACGATGTGCCCGTATCAGTATGGATGCTGCCTCGGCGTCGTGACGCGAGTATGTCGGAGCTTA
GCCGAAACGATGGAGAGCTCAATCGAAGCGAGGAGCGACGGTTAGTTCATGTGAGGAGGCTGGAACAGACGAATC
TTGCGTTTGGACTCCTGGGAGTTGAGGCAGACTTGGATCGCATAGAACTGGCAGACATCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail