Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1187
Gene name
LocationContig_134:7488..8608
Strand+
Gene length (bp)1120
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.0E-17 43 174
PF08659 KR KR domain 1.6E-09 44 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 39 326 9.0E-20
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 39 326 2.0E-16
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 39 327 1.0E-15
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 14 248 3.0E-15
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 43 326 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 39 326 9.0E-20
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 39 326 2.0E-16
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 39 327 1.0E-15
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 14 248 3.0E-15
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 43 326 8.0E-15
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 39 327 8.0E-15
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 11 328 8.0E-15
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 43 326 4.0E-13
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 38 320 7.0E-13
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 33 326 2.0E-12
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 36 326 2.0E-11
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 43 329 3.0E-11
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 40 337 3.0E-11
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 39 329 3.0E-11
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 42 329 4.0E-11
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 39 326 1.0E-10
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 37 326 7.0E-10
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 38 326 1.0E-09
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 37 326 2.0E-09
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 33 326 3.0E-08
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 45 172 5.0E-08
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 33 326 5.0E-08
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 45 172 6.0E-08
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 43 172 8.0E-08
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 45 172 2.0E-07
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 27 258 3.0E-07
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 43 172 5.0E-07
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 39 259 6.0E-07
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 20 330 9.0E-07
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 43 187 9.0E-07
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 41 135 9.0E-07
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 43 172 1.0E-06
sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 45 172 3.0E-06
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 44 171 3.0E-06
sp|Q6WAU1|IPIPR_MENPI (-)-isopiperitenone reductase OS=Mentha piperita PE=1 SV=1 43 153 8.0E-06
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 33 326 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1187
MDVAMNPSNVKPSDEASKVNFLRRQMCVTLPTVLSGDVDLADKTAIVTGGNAGLGFQCCVQLVDLGLGRLVIAAR
NEAKGQAAKEELCARKHTKTTIEVWWLDLGSYDSVQAFVERVKTLDGVDMIVQSAAMFGVDFKVNDKTKHEEMVQ
VNYLSNALLTILLLPVLRAKKRAGKPATRIAWVNSETAAWAQFKERSGESILAELDKPGGFEYLERYCTSKLLCQ
LFVVELCRRVSASTAVVVLVNPGFCWGSRLHRDVGGVVGGVLAVVKRIIGRSPEEGARTLTDAVVRHGDEVHGQY
LGDCKLKPMAPLVYQAEGAKIAEALWAETMAELEFAHVEEVLAGVGE*
Coding >OphauG2|1187
ATGGATGTGGCCATGAATCCATCCAATGTGAAGCCCTCAGATGAGGCTAGCAAGGTTAATTTTCTACGCCGCCAA
ATGTGCGTCACGCTACCGACCGTTTTGTCTGGCGATGTGGACTTGGCAGATAAGACGGCGATTGTCACTGGCGGC
AACGCTGGGCTGGGGTTTCAATGCTGTGTGCAGTTGGTGGATCTTGGTCTGGGAAGACTTGTTATCGCGGCGCGC
AACGAGGCCAAGGGCCAGGCGGCAAAGGAGGAACTATGTGCAAGGAAGCATACCAAGACAACGATTGAAGTGTGG
TGGCTTGATCTTGGGTCGTACGACTCGGTGCAGGCGTTTGTTGAGCGGGTAAAGACGCTTGATGGGGTGGACATG
ATTGTGCAGAGCGCAGCCATGTTTGGCGTCGATTTTAAAGTAAACGACAAGACGAAGCACGAGGAAATGGTTCAA
GTCAACTATCTCTCCAACGCGTTGCTTACTATTCTTCTACTTCCCGTGCTACGGGCCAAGAAGAGAGCTGGAAAG
CCAGCCACACGCATAGCCTGGGTGAATTCAGAAACGGCAGCATGGGCTCAGTTTAAAGAGAGAAGCGGGGAATCG
ATTCTAGCAGAGTTGGACAAGCCGGGGGGGTTTGAGTATCTTGAGCGGTATTGTACGTCGAAGCTGCTGTGTCAG
TTGTTTGTGGTGGAGTTGTGTAGGCGTGTTTCGGCGTCGACGGCAGTCGTGGTGTTGGTGAATCCGGGGTTTTGC
TGGGGGTCGAGGTTGCATCGCGACGTGGGAGGGGTTGTGGGGGGTGTGTTGGCGGTGGTGAAGAGGATTATTGGG
CGGTCGCCGGAAGAGGGCGCGCGGACGTTGACGGATGCGGTGGTGAGGCATGGGGATGAGGTTCATGGGCAGTAT
CTGGGCGACTGCAAGTTGAAGCCAATGGCGCCTTTGGTGTACCAAGCCGAGGGGGCAAAGATAGCGGAAGCGTTG
TGGGCAGAAACAATGGCAGAGTTGGAGTTTGCGCATGTGGAGGAGGTATTGGCAGGAGTTGGAGAATAG
Transcript >OphauG2|1187
ATGGATGTGGCCATGAATCCATCCAATGTGAAGCCCTCAGATGAGGCTAGCAAGGTTAATTTTCTACGCCGCCAA
ATGTGCGTCACGCTACCGACCGTTTTGTCTGGCGATGTGGACTTGGCAGATAAGACGGCGATTGTCACTGGCGGC
AACGCTGGGCTGGGGTTTCAATGCTGTGTGCAGTTGGTGGATCTTGGTCTGGGAAGACTTGTTATCGCGGCGCGC
AACGAGGCCAAGGGCCAGGCGGCAAAGGAGGAACTATGTGCAAGGAAGCATACCAAGACAACGATTGAAGTGTGG
TGGCTTGATCTTGGGTCGTACGACTCGGTGCAGGCGTTTGTTGAGCGGGTAAAGACGCTTGATGGGGTGGACATG
ATTGTGCAGAGCGCAGCCATGTTTGGCGTCGATTTTAAAGTAAACGACAAGACGAAGCACGAGGAAATGGTTCAA
GTCAACTATCTCTCCAACGCGTTGCTTACTATTCTTCTACTTCCCGTGCTACGGGCCAAGAAGAGAGCTGGAAAG
CCAGCCACACGCATAGCCTGGGTGAATTCAGAAACGGCAGCATGGGCTCAGTTTAAAGAGAGAAGCGGGGAATCG
ATTCTAGCAGAGTTGGACAAGCCGGGGGGGTTTGAGTATCTTGAGCGGTATTGTACGTCGAAGCTGCTGTGTCAG
TTGTTTGTGGTGGAGTTGTGTAGGCGTGTTTCGGCGTCGACGGCAGTCGTGGTGTTGGTGAATCCGGGGTTTTGC
TGGGGGTCGAGGTTGCATCGCGACGTGGGAGGGGTTGTGGGGGGTGTGTTGGCGGTGGTGAAGAGGATTATTGGG
CGGTCGCCGGAAGAGGGCGCGCGGACGTTGACGGATGCGGTGGTGAGGCATGGGGATGAGGTTCATGGGCAGTAT
CTGGGCGACTGCAAGTTGAAGCCAATGGCGCCTTTGGTGTACCAAGCCGAGGGGGCAAAGATAGCGGAAGCGTTG
TGGGCAGAAACAATGGCAGAGTTGGAGTTTGCGCATGTGGAGGAGGTATTGGCAGGAGTTGGAGAATAG
Gene >OphauG2|1187
ATGGATGTGGCCATGAATCCATCCAATGTGAAGCCCTCAGATGAGGCTAGCAAGGTTAATTTTCTACGCCGCCAA
ATGTGCGTCACGCTACCGACCGTTTTGTCTGGCGATGTGGACTTGGCAGATAAGACGGCGATTGTCACTGGCGGC
AACGCTGGGCTGGGGTTTCAATGCTGTGTGCAGTTGGTGGATCTTGGTCTGGGAAGACTTGTTATCGCGGCGCGC
AACGAGGCCAAGGGCCAGGCGGCAAAGGAGGAACTATGTGCAAGGAAGCATACCAAGACAACGATTGAAGTGTGG
TGGCTTGATCTTGGGTCGTACGACTCGGTGCAGGCGTTTGTTGAGCGGGTAAAGACGCTTGATGGGGTGGACATG
ATTGTGCAGAGCGCAGCCATGTTTGGCGTCGATTTTAAAGTAAACGACAAGACGAAGCACGAGGAAATGGTTCAA
GTCAACTATCTCTCCAACGCGTTGCTTACTATTCTTCTACTTCCCGTGCTACGGGCCAAGAAGAGAGCTGGAAAG
CCAGCCACACGCATAGCCTGGGTGAATTCAGAAACGGCAGCATGGGCTCAGTTTAAAGAGAGAAGCGGGGAATCG
ATTCTAGCAGAGTTGGACAAGCCGGGGGGGTTTGAGTATCTTGAGCGGTATTGTACGTCGAAGCTGCTGTGTCAG
TTGTTTGTGGTGGAGTTGTGTAGGCGTGTTTCGGCGTCGACGGCAGTCGTGGTGTTGGTGAATCCGGGGTTTTGC
TGGGGGTCGAGGTTGCATCGCGACGTGGGAGGGGTTGTGGGGGGTGTGTTGGCGGTGGTGAAGAGGATTATTGGG
CGGTCGCCGGAAGAGGGCGCGCGGACGTTGACGGATGCGGTGGTGAGGCATGGGGATGAGGTTCATGGGCAGTAT
CTGGGCGACTGCAAGTTGAAGCCGTGAGTTTTCTCTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGTTTTGTGAGT
TTTGATTTTGACTGATTTGGATAGAATGGCGCCTTTGGTGTACCAAGCCGAGGGGGCAAAGATAGCGGAAGCGTT
GTGGGCAGAAACAATGGCAGAGTTGGAGTTTGCGCATGTGGAGGAGGTATTGGCAGGAGTTGGAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail