Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1179
Gene name
LocationContig_1335:1104..4292
Strand-
Gene length (bp)3188
Transcript length (bp)2745
Coding sequence length (bp)2745
Protein length (aa) 915

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11916 Vac14_Fig4_bd Vacuolar protein 14 C-terminal Fig4p binding 5.2E-78 603 781
PF12755 Vac14_Fab1_bd Vacuolar 14 Fab1-binding region 4.9E-41 66 161
PF02985 HEAT HEAT repeat 5.8E-04 92 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06708|VAC14_YEAST Vacuole morphology and inheritance protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC14 PE=1 SV=1 7 848 0.0E+00
sp|P87145|VAC14_SCHPO Protein VAC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.03 PE=3 SV=1 7 850 0.0E+00
sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 382 839 4.0E-89
sp|Q66L58|VAC14_DANRE Protein VAC14 homolog OS=Danio rerio GN=vac14 PE=2 SV=1 382 839 3.0E-88
sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 382 845 6.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06708|VAC14_YEAST Vacuole morphology and inheritance protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC14 PE=1 SV=1 7 848 0.0E+00
sp|P87145|VAC14_SCHPO Protein VAC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.03 PE=3 SV=1 7 850 0.0E+00
sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 382 839 4.0E-89
sp|Q66L58|VAC14_DANRE Protein VAC14 homolog OS=Danio rerio GN=vac14 PE=2 SV=1 382 839 3.0E-88
sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 382 845 6.0E-88
sp|Q80WQ2|VAC14_MOUSE Protein VAC14 homolog OS=Mus musculus GN=Vac14 PE=1 SV=1 382 845 1.0E-87
sp|Q08AM6|VAC14_HUMAN Protein VAC14 homolog OS=Homo sapiens GN=VAC14 PE=1 SV=1 382 845 1.0E-85
sp|Q5ZIW5|VAC14_CHICK Protein VAC14 homolog OS=Gallus gallus GN=VAC14 PE=2 SV=1 382 841 6.0E-83
sp|A2VE70|VAC14_BOVIN Protein VAC14 homolog OS=Bos taurus GN=VAC14 PE=2 SV=1 382 845 9.0E-83
sp|Q9ZU97|VAC14_ARATH Protein VAC14 homolog OS=Arabidopsis thaliana GN=VAC14 PE=1 SV=2 1 421 2.0E-75
sp|Q66L58|VAC14_DANRE Protein VAC14 homolog OS=Danio rerio GN=vac14 PE=2 SV=1 10 282 5.0E-69
sp|Q08AM6|VAC14_HUMAN Protein VAC14 homolog OS=Homo sapiens GN=VAC14 PE=1 SV=1 10 282 1.0E-68
sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 10 283 2.0E-68
sp|Q80WQ2|VAC14_MOUSE Protein VAC14 homolog OS=Mus musculus GN=Vac14 PE=1 SV=1 7 282 6.0E-68
sp|A2VE70|VAC14_BOVIN Protein VAC14 homolog OS=Bos taurus GN=VAC14 PE=2 SV=1 7 282 6.0E-68
sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 7 282 1.0E-67
sp|Q5ZIW5|VAC14_CHICK Protein VAC14 homolog OS=Gallus gallus GN=VAC14 PE=2 SV=1 10 282 2.0E-67
sp|Q9ZU97|VAC14_ARATH Protein VAC14 homolog OS=Arabidopsis thaliana GN=VAC14 PE=1 SV=2 522 838 1.0E-64
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5053
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1179 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5089
Ophiocordyceps camponoti-floridani Ophcf2|03250
Ophiocordyceps camponoti-rufipedis Ophun1|4874
Ophiocordyceps kimflemingae Ophio5|8625
Ophiocordyceps subramaniannii Hirsu2|2743

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1179
MSRAFTMDANIHRALTDKLYDKRKLGALELERIIREVVASNNEERLNDILDQLINDYAYAVHQPHARNGGLIGLA
AAAIALGPQLARYLAKIVPPVLACFTDQDARVRYYACEAMYNIAKVAKGEILVYFNSIFDQLCRLGADAELSVKN
GAELLDRLIKDIVSESASSYVSVLEAESEVEVDDGNKLALDRNNAAPSSPRTAFSLPRFIPLLKERIWVMNPFTR
QFLVGWITLLDSIPDLELVTYLPEFLAGLLKFLSDQNLDVRTATHSCLDKFLNEIKRIARVKKGLVESRKWRQGS
KRRRQDSGDTGSLHPDLEEGDEVYSDTVNDDDYDQGRDMDEDGGSSLDEDWIPGQDVEINYKQILEILTATLDSP
LEEYCLLESLRWIVEFLNICPEEVLPFTPKILAHMLPAMASSKETIRQAAIRVNTCLMDYVVSLSDESVVGHSQQ
PQVTPSRPPLVNTSDKADEITSTKASLSGFHEREATSPTPGSGQSWSGALPPSPVDLDYAAAVNSLTLLFLNDHE
ATRVAALTWLIMLHRKAPRKVLAFNDGTFPALLKTLSDPSDAVVTKDLQLLSQISRHSEDDYFANFMVNLLQLFS
TDRKLLETRGNLIIRQLCISLSPERIYRTLADCIEKEEDVEFASTMVQNLNNNLITAPQLGEVRKRLRTLDTKDG
QTLFITLFRSWCYNAVATFSLCLLAQAYEQAYHLLQIFGELDMTVNLLIQVDKLVQLIESPVFTYLRLQLLEPEK
YPYLYKCMYGILMLLPQSSAFAALKNRLNSVSAIGYLQVVPRSTSTSSGSSNFDRPNRLKGRDEGGIRWVELLDK
FRSVQERARKTRRQMADGDDGASAGMSDLRMNEPGFGTGQKEGRGVVSVLAPPKDSTPVAPTAPAKRTGLGRQFG
RLGGAVSGKSRRNQ*
Coding >OphauG2|1179
ATGTCTCGGGCGTTTACTATGGATGCTAATATCCATCGGGCCTTGACAGACAAGCTCTACGATAAGCGCAAGTTA
GGTGCGCTCGAGCTCGAGAGAATTATACGAGAGGTAGTGGCGTCTAATAACGAAGAGCGACTCAACGACATTCTC
GATCAGCTCATCAACGATTACGCCTATGCAGTACACCAGCCTCATGCCCGAAATGGCGGTCTCATAGGTCTGGCG
GCCGCCGCTATAGCTCTTGGCCCGCAACTCGCGCGATATCTGGCCAAAATTGTACCTCCAGTGCTGGCATGCTTC
ACGGACCAAGATGCCAGGGTTAGATATTATGCCTGCGAAGCCATGTACAACATCGCAAAGGTGGCCAAAGGGGAG
ATCTTGGTATACTTTAACAGCATCTTTGATCAACTCTGTAGGCTCGGTGCCGATGCTGAGCTCTCTGTAAAAAAT
GGAGCCGAGCTGTTAGACCGACTCATCAAAGACATTGTTTCCGAGTCGGCATCTTCTTACGTGTCAGTGCTGGAA
GCCGAGTCGGAGGTCGAGGTTGACGACGGGAACAAATTGGCACTTGACAGGAATAACGCAGCACCATCATCACCC
CGTACCGCCTTCTCGTTACCTCGTTTCATTCCACTGCTAAAGGAGCGCATTTGGGTCATGAATCCATTTACACGG
CAGTTCCTCGTTGGGTGGATTACTCTTCTTGACTCCATACCTGACTTGGAACTCGTCACCTACCTCCCCGAGTTT
CTGGCCGGTCTGCTCAAATTTCTTAGTGATCAGAATCTTGATGTGCGTACTGCCACACACTCGTGTCTCGACAAA
TTTCTCAATGAGATCAAGCGAATTGCACGCGTAAAGAAGGGTCTGGTTGAGAGCAGAAAATGGCGCCAGGGCAGC
AAGCGGAGGCGTCAAGACTCGGGCGACACGGGCAGCTTGCATCCTGATCTGGAAGAAGGCGACGAAGTGTATTCA
GACACAGTCAATGACGACGATTATGACCAAGGACGTGACATGGATGAGGATGGTGGTAGCAGCTTGGATGAGGAC
TGGATTCCTGGTCAAGATGTCGAGATCAATTACAAGCAAATATTAGAGATTTTGACTGCAACGCTTGATTCTCCA
CTAGAAGAGTATTGCCTGTTGGAATCTCTGAGATGGATCGTCGAATTTCTTAACATCTGTCCTGAAGAAGTGCTG
CCATTTACCCCCAAGATACTTGCTCACATGTTGCCAGCCATGGCCAGCAGCAAAGAAACGATTCGTCAAGCGGCA
ATTAGGGTCAATACCTGTCTAATGGACTACGTCGTCTCACTATCTGATGAGTCTGTTGTGGGCCATAGCCAACAA
CCTCAAGTAACCCCTTCGCGGCCTCCACTAGTCAATACCAGCGACAAGGCAGATGAAATCACGAGCACCAAGGCA
TCGTTATCGGGTTTTCATGAACGGGAAGCAACGAGCCCAACGCCGGGCTCAGGGCAGTCTTGGTCTGGTGCATTG
CCCCCTTCCCCCGTCGACCTCGACTACGCGGCGGCCGTGAACTCGCTCACTCTGCTCTTCCTCAACGACCACGAG
GCAACAAGAGTGGCTGCTTTGACATGGCTCATTATGCTTCACCGCAAGGCTCCCCGCAAAGTGCTGGCCTTTAAC
GATGGCACTTTTCCCGCCCTTCTCAAGACACTGTCAGACCCTTCGGATGCTGTTGTCACCAAGGACCTCCAGCTC
TTGTCACAGATTTCGCGTCATAGCGAGGATGACTATTTCGCGAATTTCATGGTCAACCTTTTGCAGCTCTTCTCG
ACAGATCGCAAACTCTTGGAAACTCGAGGAAATCTTATTATTCGCCAGCTGTGCATAAGCCTCAGCCCAGAGCGC
ATATACCGCACACTGGCTGACTGTATTGAAAAGGAGGAGGATGTCGAGTTTGCTAGTACAATGGTGCAGAACCTC
AACAATAACCTCATTACGGCACCTCAGCTTGGCGAGGTGCGCAAGAGGCTGCGAACCCTCGACACAAAGGACGGT
CAAACGCTGTTTATAACGCTGTTTCGATCGTGGTGCTACAATGCTGTGGCAACATTTTCGCTCTGCTTGCTGGCC
CAGGCGTACGAACAGGCTTATCATTTGTTACAGATCTTTGGCGAGCTGGACATGACTGTCAATCTTTTGATTCAA
GTTGATAAACTAGTACAGCTGATTGAATCCCCCGTCTTCACCTATCTTAGACTGCAATTATTGGAACCGGAAAAG
TATCCGTATTTATACAAGTGCATGTACGGTATCCTTATGCTCCTGCCACAGTCGTCGGCTTTTGCCGCTCTCAAG
AATCGGCTCAACAGTGTGAGTGCTATAGGCTACCTGCAGGTCGTGCCTCGAAGCACCTCGACGTCTAGTGGTAGC
TCCAACTTCGACCGGCCGAACCGGCTCAAAGGACGCGACGAGGGAGGCATTCGATGGGTCGAATTGCTGGACAAG
TTCCGCAGCGTGCAAGAAAGAGCCAGGAAAACGCGGCGGCAAATGGCAGATGGCGATGACGGAGCTTCGGCTGGC
ATGAGCGATTTGCGCATGAACGAACCAGGCTTTGGAACGGGACAGAAAGAGGGCCGTGGGGTGGTATCGGTACTG
GCACCTCCAAAGGACTCCACACCAGTGGCACCAACTGCGCCTGCAAAAAGGACTGGACTGGGTAGGCAGTTTGGT
CGATTGGGAGGCGCTGTATCTGGTAAGAGCCGACGAAATCAGTAG
Transcript >OphauG2|1179
ATGTCTCGGGCGTTTACTATGGATGCTAATATCCATCGGGCCTTGACAGACAAGCTCTACGATAAGCGCAAGTTA
GGTGCGCTCGAGCTCGAGAGAATTATACGAGAGGTAGTGGCGTCTAATAACGAAGAGCGACTCAACGACATTCTC
GATCAGCTCATCAACGATTACGCCTATGCAGTACACCAGCCTCATGCCCGAAATGGCGGTCTCATAGGTCTGGCG
GCCGCCGCTATAGCTCTTGGCCCGCAACTCGCGCGATATCTGGCCAAAATTGTACCTCCAGTGCTGGCATGCTTC
ACGGACCAAGATGCCAGGGTTAGATATTATGCCTGCGAAGCCATGTACAACATCGCAAAGGTGGCCAAAGGGGAG
ATCTTGGTATACTTTAACAGCATCTTTGATCAACTCTGTAGGCTCGGTGCCGATGCTGAGCTCTCTGTAAAAAAT
GGAGCCGAGCTGTTAGACCGACTCATCAAAGACATTGTTTCCGAGTCGGCATCTTCTTACGTGTCAGTGCTGGAA
GCCGAGTCGGAGGTCGAGGTTGACGACGGGAACAAATTGGCACTTGACAGGAATAACGCAGCACCATCATCACCC
CGTACCGCCTTCTCGTTACCTCGTTTCATTCCACTGCTAAAGGAGCGCATTTGGGTCATGAATCCATTTACACGG
CAGTTCCTCGTTGGGTGGATTACTCTTCTTGACTCCATACCTGACTTGGAACTCGTCACCTACCTCCCCGAGTTT
CTGGCCGGTCTGCTCAAATTTCTTAGTGATCAGAATCTTGATGTGCGTACTGCCACACACTCGTGTCTCGACAAA
TTTCTCAATGAGATCAAGCGAATTGCACGCGTAAAGAAGGGTCTGGTTGAGAGCAGAAAATGGCGCCAGGGCAGC
AAGCGGAGGCGTCAAGACTCGGGCGACACGGGCAGCTTGCATCCTGATCTGGAAGAAGGCGACGAAGTGTATTCA
GACACAGTCAATGACGACGATTATGACCAAGGACGTGACATGGATGAGGATGGTGGTAGCAGCTTGGATGAGGAC
TGGATTCCTGGTCAAGATGTCGAGATCAATTACAAGCAAATATTAGAGATTTTGACTGCAACGCTTGATTCTCCA
CTAGAAGAGTATTGCCTGTTGGAATCTCTGAGATGGATCGTCGAATTTCTTAACATCTGTCCTGAAGAAGTGCTG
CCATTTACCCCCAAGATACTTGCTCACATGTTGCCAGCCATGGCCAGCAGCAAAGAAACGATTCGTCAAGCGGCA
ATTAGGGTCAATACCTGTCTAATGGACTACGTCGTCTCACTATCTGATGAGTCTGTTGTGGGCCATAGCCAACAA
CCTCAAGTAACCCCTTCGCGGCCTCCACTAGTCAATACCAGCGACAAGGCAGATGAAATCACGAGCACCAAGGCA
TCGTTATCGGGTTTTCATGAACGGGAAGCAACGAGCCCAACGCCGGGCTCAGGGCAGTCTTGGTCTGGTGCATTG
CCCCCTTCCCCCGTCGACCTCGACTACGCGGCGGCCGTGAACTCGCTCACTCTGCTCTTCCTCAACGACCACGAG
GCAACAAGAGTGGCTGCTTTGACATGGCTCATTATGCTTCACCGCAAGGCTCCCCGCAAAGTGCTGGCCTTTAAC
GATGGCACTTTTCCCGCCCTTCTCAAGACACTGTCAGACCCTTCGGATGCTGTTGTCACCAAGGACCTCCAGCTC
TTGTCACAGATTTCGCGTCATAGCGAGGATGACTATTTCGCGAATTTCATGGTCAACCTTTTGCAGCTCTTCTCG
ACAGATCGCAAACTCTTGGAAACTCGAGGAAATCTTATTATTCGCCAGCTGTGCATAAGCCTCAGCCCAGAGCGC
ATATACCGCACACTGGCTGACTGTATTGAAAAGGAGGAGGATGTCGAGTTTGCTAGTACAATGGTGCAGAACCTC
AACAATAACCTCATTACGGCACCTCAGCTTGGCGAGGTGCGCAAGAGGCTGCGAACCCTCGACACAAAGGACGGT
CAAACGCTGTTTATAACGCTGTTTCGATCGTGGTGCTACAATGCTGTGGCAACATTTTCGCTCTGCTTGCTGGCC
CAGGCGTACGAACAGGCTTATCATTTGTTACAGATCTTTGGCGAGCTGGACATGACTGTCAATCTTTTGATTCAA
GTTGATAAACTAGTACAGCTGATTGAATCCCCCGTCTTCACCTATCTTAGACTGCAATTATTGGAACCGGAAAAG
TATCCGTATTTATACAAGTGCATGTACGGTATCCTTATGCTCCTGCCACAGTCGTCGGCTTTTGCCGCTCTCAAG
AATCGGCTCAACAGTGTGAGTGCTATAGGCTACCTGCAGGTCGTGCCTCGAAGCACCTCGACGTCTAGTGGTAGC
TCCAACTTCGACCGGCCGAACCGGCTCAAAGGACGCGACGAGGGAGGCATTCGATGGGTCGAATTGCTGGACAAG
TTCCGCAGCGTGCAAGAAAGAGCCAGGAAAACGCGGCGGCAAATGGCAGATGGCGATGACGGAGCTTCGGCTGGC
ATGAGCGATTTGCGCATGAACGAACCAGGCTTTGGAACGGGACAGAAAGAGGGCCGTGGGGTGGTATCGGTACTG
GCACCTCCAAAGGACTCCACACCAGTGGCACCAACTGCGCCTGCAAAAAGGACTGGACTGGGTAGGCAGTTTGGT
CGATTGGGAGGCGCTGTATCTGGTAAGAGCCGACGAAATCAGTAG
Gene >OphauG2|1179
ATGTCTCGGGCGTTTACTATGGATGCTAATATCCATCGGGCCTTGACAGACAAGCTCTACGATAAGCGCAAGTTA
GGTGCGCTCGAGTTGGTCTCCTCATGCATTTTGAAGCTAAGTGCGCATGGGGCTAACGCTTCGGCAGGCTCGAGA
GAATTATACGAGAGGTAGTGGCGTCTAATAACGAAGAGCGACTCAACGACATTCTCGATCAGCTCATCAACGATT
ACGCCTATGCAGTACACCAGCCTCATGCCCGAAATGGCGGTCTCATAGGTCTGGCGGCCGCCGCTATAGCTCTTG
GCCCGGTCCGTCAAGCCCTATCTGCCGTTGTACAAGACTGGTTAGATTACTGATGCTGGCTGCACTGTCTGGATT
TGGTTCTCGAATAGCAACTCGCGCGATATCTGGCCAAAATTGTACCTCCAGTGCTGGCATGCTTCACGGACCAAG
ATGCCAGGGTTAGATATTATGCCTGCGAAGCCATGTACAACATCGCAAAGGTGGCCAAAGGGGAGATCTTGGTAT
ACTTTAACAGCATCTTTGATCAACTCTGTAGGGTATGTTGTCCCGCTTGGTGTCGAAGAGCGCGCTTTGCTGACA
TTGTCAGCTCGGTGCCGATGCTGAGCTCTCTGTAAAAAATGGAGCCGAGCTGTTAGACCGACTCATCAAAGACAT
TGTTTCCGAGTCGGCATCTTCTTACGTGTCAGTGCTGGAAGCCGAGTCGGAGGTCGAGGTTGACGACGGGAACAA
ATTGGCACTTGACAGGAATAACGCAGCACCATCATCACCCCGTACCGCCTTCTCGTTACCTCGTTTCATTCCACT
GCTAAAGGAGCGCATTTGGGTCATGAATCCATTTACACGGCAGTTCCTCGTTGGGTGGATTACTCTTCTTGACTC
CATACCTGACTTGGAACTCGTCACCTACCTCCCCGAGTTTCTGGCCGGTCTGCTCAAATTTCTTAGTGATCAGAA
TCTTGATGTGCGTACTGCCACACACTCGTGTCTCGACAAATTTCTCAATGAGATCAAGCGAATTGCACGCGTAAA
GAAGGGTCTGGTTGAGAGCAGAAAATGGCGCCAGGGCAGCAAGCGGAGGCGTCAAGACTCGGGCGACACGGGCAG
CTTGCATCCTGATCTGGAAGAAGGCGACGAAGTGTATTCAGACACAGTCAATGACGACGATTATGACCAAGGACG
TGACATGGATGAGGATGGTGGTAGCAGCTTGGATGAGGACTGGATTCCTGGTCAAGATGTCGAGATCAATTACAA
GCAAATATTAGAGATTTTGACTGCAACGCTTGATTCTCCACTAGGTAGGTGTTCCCGTGTTTGGCAAGACTGGGC
GTCCTGAGAAGCTGACGAATAGGCAATACATGGCAGAAGAGTATTGCCTGTTGGAATCTCTGAGATGGATCGTCG
AATTTCTTAACATCTGTCCTGAAGAAGTGCTGCCATTTACCCCCAAGATACTTGCTCACATGTTGCCAGCCATGG
CCAGCAGCAAAGAAACGATTCGTCAAGCGGCAATTAGGGTCAATACCTGTCTAATGGACTACGTCGTCTCACTAT
CTGATGAGTCTGTTGTGGGCCATAGCCAACAACCTCAAGTAACCCCTTCGCGGCCTCCACTAGTCAATACCAGCG
ACAAGGCAGATGAAATCACGAGCACCAAGGCATCGTTATCGGGTTTTCATGAACGGGAAGCAACGAGCCCAACGC
CGGGCTCAGGGCAGTCTTGGTCTGGTGCATTGCCCCCTTCCCCCGTCGACCTCGACTACGCGGCGGCCGTGAACT
CGCTCACTCTGCTCTTCCTCAACGACCACGAGGCAACAAGAGTGGCTGCTTTGACATGGCTCATTATGCTTCACC
GCAAGGCTCCCCGCAAAGTGCTGGCCTTTAACGATGGCACTTTTCCCGCCCTTCTCAAGACACTGTCAGACCCTT
CGGATGCTGTTGTCACCAAGGACCTCCAGCTCTTGTCACAGATTTCGCGTCATAGCGAGGATGACTATTTCGCGA
ATTTCATGGTCAACCTTTTGCAGCTCTTCTCGACAGATCGCAAACTCTTGGAAACTCGAGGAAATCTTATTATTC
GCCAGCTGTGCATAAGCCTCAGCCCAGAGCGCATATACCGCACACTGGCTGACTGTATTGAAAAGGAGGAGGATG
TCGAGTTTGCTAGTACAATGGTGCAGAACCTCAACAATAACCTCATTACGGCACCTCAGCTTGGCGAGGTGCGCA
AGAGGCTGCGAACCCTCGACACAAAGGACGGTCAAACGCTGTTTATAACGCTGTTTCGATCGTGGTGCTACAATG
CTGTGGCAACATTTTCGCTCTGCTTGCTGGCCCAGGCGTACGAACAGGCTTATCATTTGTTACAGATCTTGTCAG
CAGGAACCTGCCCTGTTGCTGTAATAAGAAGCGTCATGCTGACATTGAACAGTGGCGAGCTGGACATGACTGTCA
ATCTTTTGATTCAAGTTGATAAACTAGTACAGCTGATTGAATCCCCCGTCTTCACCTGTGCGTAGCATGCACTTG
AATGATGCTGCTAAAATAATTACTGACTGATTCCTTGGGTAGATCTTAGACTGCAATTATTGGAACCGGAAAAGT
ATCCGTATTTATACAAGTGCATGTACGGTATCCTTATGCTCCTGCCACAGTCGTCGGCTTTTGCCGCTCTCAAGA
ATCGGCTCAACAGTGTGAGTGCTATAGGCTACCTGCAGGTCGTGCCTCGAAGGTGAGTGGCCTTTGTTTTTATGG
AGCAATGCCAGCCAGGAGGGCAAAATTGTGACTAGAGGAAACACAGCACCTCGACGTCTAGTGGTAGCTCCAACT
TCGACCGGCCGAACCGGCTCAAAGGACGCGACGAGGGAGGCATTCGATGGGTCGAATTGCTGGACAAGTTCCGCA
GCGTGCAAGAAAGAGCCAGGAAAACGCGGCGGCAAATGGCAGATGGCGATGACGGAGCTTCGGCTGGCATGAGCG
ATTTGCGCATGAACGAACCAGGCTTTGGAACGGGACAGAAAGAGGGCCGTGGGGTGGTATCGGTACTGGCACCTC
CAAAGGACTCCACACCAGTGGCACCAACTGCGCCTGCAAAAAGGACTGGACTGGGTAGGCAGTTTGGTCGATTGG
GAGGCGCTGTATCTGGTAAGAGCCGACGAAATCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail