Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1176
Gene name
LocationContig_1334:182..1081
Strand+
Gene length (bp)899
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01987 AIM24 Mitochondrial biogenesis AIM24 5.5E-50 29 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5XDZ5|Y233_STRP6 Uncharacterized protein M6_Spy0233 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0233 PE=1 SV=1 39 232 3.0E-18

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup476
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1176 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7225
Ophiocordyceps camponoti-floridani Ophcf2|05480
Ophiocordyceps camponoti-rufipedis Ophun1|243
Ophiocordyceps kimflemingae Ophio5|7412
Ophiocordyceps subramaniannii Hirsu2|10560
Ophiocordyceps subramaniannii Hirsu2|3916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1176
MHAGAPPPGLFVGAGAVVDDVGTFNGGSYRISHRDTNTLLTIQLAMGCPLDGKAGAMIAMSPTVTVKGQIKFSVK
KVIAGADINSTRFIGPGELLLAPPMLGDITSVRISGNENWSVGHDAYLASTQGVIKDHKRQGLGKALFSGEGLWV
YRLSGTGIMWISSFGAIIRKDLIEGERYIVDNGHLVAWNTKYVLERVTSGGFISNFASGEGLVCKFTGPGTVFIQ
TRNAKAFTAYIGGQAVQG*
Coding >OphauG2|1176
ATGCATGCCGGAGCACCGCCACCAGGTCTTTTCGTGGGCGCCGGGGCTGTGGTAGACGATGTGGGGACCTTTAAT
GGCGGTAGTTATCGAATTAGTCACAGGGACACCAATACTCTTCTCACCATTCAGCTGGCAATGGGCTGTCCCCTG
GATGGCAAAGCAGGAGCAATGATTGCCATGTCCCCGACAGTCACAGTCAAAGGGCAAATAAAATTCAGCGTCAAA
AAAGTAATTGCGGGGGCAGATATCAACTCTACCAGATTCATTGGTCCCGGAGAGCTACTGCTTGCTCCGCCCATG
CTTGGAGATATTACTAGCGTTCGAATATCTGGCAACGAGAATTGGTCAGTTGGGCACGACGCTTATCTAGCCTCG
ACTCAAGGCGTCATCAAGGACCATAAGCGACAAGGCCTAGGCAAGGCCTTATTCAGCGGCGAAGGCCTATGGGTC
TATAGGCTCAGCGGAACGGGAATCATGTGGATTTCAAGCTTTGGGGCCATCATCAGAAAAGACCTCATTGAGGGC
GAGAGGTATATTGTCGATAACGGCCATCTTGTGGCGTGGAATACCAAGTACGTGCTAGAGAGGGTAACCTCTGGA
GGATTCATCTCGAATTTCGCCTCTGGAGAAGGGTTGGTTTGCAAATTTACCGGGCCTGGAACTGTGTTCATTCAG
ACTCGAAACGCGAAGGCCTTTACCGCCTATATTGGTGGGCAAGCAGTTCAAGGCTAA
Transcript >OphauG2|1176
ATGCATGCCGGAGCACCGCCACCAGGTCTTTTCGTGGGCGCCGGGGCTGTGGTAGACGATGTGGGGACCTTTAAT
GGCGGTAGTTATCGAATTAGTCACAGGGACACCAATACTCTTCTCACCATTCAGCTGGCAATGGGCTGTCCCCTG
GATGGCAAAGCAGGAGCAATGATTGCCATGTCCCCGACAGTCACAGTCAAAGGGCAAATAAAATTCAGCGTCAAA
AAAGTAATTGCGGGGGCAGATATCAACTCTACCAGATTCATTGGTCCCGGAGAGCTACTGCTTGCTCCGCCCATG
CTTGGAGATATTACTAGCGTTCGAATATCTGGCAACGAGAATTGGTCAGTTGGGCACGACGCTTATCTAGCCTCG
ACTCAAGGCGTCATCAAGGACCATAAGCGACAAGGCCTAGGCAAGGCCTTATTCAGCGGCGAAGGCCTATGGGTC
TATAGGCTCAGCGGAACGGGAATCATGTGGATTTCAAGCTTTGGGGCCATCATCAGAAAAGACCTCATTGAGGGC
GAGAGGTATATTGTCGATAACGGCCATCTTGTGGCGTGGAATACCAAGTACGTGCTAGAGAGGGTAACCTCTGGA
GGATTCATCTCGAATTTCGCCTCTGGAGAAGGGTTGGTTTGCAAATTTACCGGGCCTGGAACTGTGTTCATTCAG
ACTCGAAACGCGAAGGCCTTTACCGCCTATATTGGTGGGCAAGCAGTTCAAGGCTAA
Gene >OphauG2|1176
ATGCATGCCGGAGCACCGCCACCAGGTCTTTTCGTGGGCGCCGGGGCTGTGGTAGACGATGTGGGGACCTTTAAT
GGCGGTAGTTATCGAATTAGTCACAGGGACACCAATACTCTTCTCACCATTCAGCTGGCAATGGGCTGTCCCCTG
GATGGCAAAGCAGGTCTGCAAAGCTCCTCCTGGTCTTTGCCTATACAACTGACAGTGGTTCAGGAGCAATGATTG
CCATGTCCCCGACAGTCACAGTCAAAGGGCAAATAAAATTCAGCGTCAAAAAAGTAATTGCGGGGGCAGATATCA
ACTCTACCAGATTCATTGGTCCCGGAGAGCTACTGCTTGCTCCGCCCATGCTTGGAGATATTACTAGCGTTCGAA
TATCTGGCAACGAGAATTGGTCAGTTGGGCACGACGCTTATCTAGCCTCGACTCAAGGCGTCATCAAGGACCATA
AGCGACAAGGCCTAGGCAAGGCCTTATTCAGCGGCGAAGGCCTATGGGTCTATAGGCTCAGCGGAACGGGAATCA
TGTGGATTTCAAGCTTTGGGGCCATCATCAGAAAAGACGTGAGTAAGAGCATGACGCGATTTAAAGCCACAAATT
GCTAACACGATTATTACATAGCTCATTGAGGGCGAGAGGTATATTGTCGATAACGGCCATCTTGTGGCGTGGAAT
ACCAAGTACGTGCTAGAGAGGGTAACCTCTGGAGGATTCATCTCGAATTTCGCCTCTGGAGAAGGGTTGGTTTGC
AAATTTACCGGGCCTGGAACTGTGTTCATTCAGACTCGAAACGCGGTAAGCCTCTTTCACCGCGCCAGCATGGTG
AATCTACAAATACTGATGCCCCTGTACAGAAGGCCTTTACCGCCTATATTGGTGGGCAAGCAGTTCAAGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail